BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0542.Seq (728 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory pro... 31 0.013 DQ855500-1|ABH88187.1| 126|Tribolium castaneum chemosensory pro... 28 0.067 DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory pro... 27 0.12 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 1.9 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 1.9 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 1.9 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 1.9 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 1.9 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 1.9 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 1.9 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 1.9 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 1.9 >DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory protein 17 protein. Length = 124 Score = 30.7 bits (66), Expect = 0.013 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +3 Query: 267 EATENLDEIRDRKENERAVSTEKHKHGITKKLSSITKKRSS 389 E E +I D +NE A EKHK G+ K + + K + S Sbjct: 55 EGEELKKDIPDALQNECAKCNEKHKEGVRKVIRHLIKNKPS 95 >DQ855500-1|ABH88187.1| 126|Tribolium castaneum chemosensory protein 14 protein. Length = 126 Score = 28.3 bits (60), Expect = 0.067 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +3 Query: 267 EATENLDEIRDRKENERAVSTEKHKHGITKKLSSITKKR 383 E E +I + +NE A EKHK G+ K L + K + Sbjct: 56 EGEELKRDIPEALQNECAKCNEKHKEGVRKVLHHLIKNK 94 >DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory protein 13 protein. Length = 124 Score = 27.5 bits (58), Expect = 0.12 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 288 EIRDRKENERAVSTEKHKHGITKKLSSITKKR 383 +I D +NE A +KHK GI K + + K++ Sbjct: 61 DIPDALKNECAKCNDKHKEGIRKVIHYLVKQK 92 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 660 VSCSAAGPDTTPPLSTRSH 716 +S + A P +TPPLST S+ Sbjct: 116 LSTNGAPPRSTPPLSTPSN 134 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 660 VSCSAAGPDTTPPLSTRSH 716 +S + A P +TPPLST S+ Sbjct: 116 LSTNGAPPRSTPPLSTPSN 134 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 660 VSCSAAGPDTTPPLSTRSH 716 +S + A P +TPPLST S+ Sbjct: 116 LSTNGAPPRSTPPLSTPSN 134 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 660 VSCSAAGPDTTPPLSTRSH 716 +S + A P +TPPLST S+ Sbjct: 116 LSTNGAPPRSTPPLSTPSN 134 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 660 VSCSAAGPDTTPPLSTRSH 716 +S + A P +TPPLST S+ Sbjct: 116 LSTNGAPPRSTPPLSTPSN 134 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 660 VSCSAAGPDTTPPLSTRSH 716 +S + A P +TPPLST S+ Sbjct: 72 LSTNGAPPRSTPPLSTPSN 90 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 660 VSCSAAGPDTTPPLSTRSH 716 +S + A P +TPPLST S+ Sbjct: 116 LSTNGAPPRSTPPLSTPSN 134 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 660 VSCSAAGPDTTPPLSTRSH 716 +S + A P +TPPLST S+ Sbjct: 116 LSTNGAPPRSTPPLSTPSN 134 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 660 VSCSAAGPDTTPPLSTRSH 716 +S + A P +TPPLST S+ Sbjct: 116 LSTNGAPPRSTPPLSTPSN 134 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,954 Number of Sequences: 336 Number of extensions: 3640 Number of successful extensions: 18 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -