BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0540.Seq (518 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 23 1.6 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 23 1.6 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 2.1 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 5.0 AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 21 6.5 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 8.7 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 23.0 bits (47), Expect = 1.6 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +3 Query: 264 MQYRPQLPIHIHNDLRSFVPPTLGVXPS 347 + Y P P++ H+ R P GV P+ Sbjct: 160 LHYPPPPPVYTHHYARYHPYPNFGVPPA 187 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 23.0 bits (47), Expect = 1.6 Identities = 11/36 (30%), Positives = 14/36 (38%) Frame = +2 Query: 221 QHQCCXTSNIRXRTNAIPTSVAYSHTQRPEIFCPAH 328 Q C T + NAI V Q+P + P H Sbjct: 563 QQNCMCTHKVDIPLNAIVEIVLVDEVQQPNLSHPFH 598 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 22.6 bits (46), Expect = 2.1 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +1 Query: 73 NIMQMNNIPFSTSLTAPAENNMPVWELQQPNITGVQESPFR 195 N++ ++PF N+ V +L NIT V + FR Sbjct: 204 NLVVAPSVPFEQDTGLGGLQNIKVLDLSFNNITSVAKQFFR 244 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.4 bits (43), Expect = 5.0 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +2 Query: 155 NSPISQEYKRVPSDFS*IRHP 217 ++P+S K+ PS F+ HP Sbjct: 349 HNPMSHHLKQEPSGFTSSNHP 369 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 21.0 bits (42), Expect = 6.5 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +3 Query: 102 LNKFDCTCREQYAG 143 +N F C C+E + G Sbjct: 87 INAFQCICKEGWEG 100 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 20.6 bits (41), Expect = 8.7 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 160 AVEAPTPAYCSLQVQSNLLRK 98 A+E P P S+Q N +RK Sbjct: 483 AIEKPAPVKISVQEVLNRVRK 503 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,386 Number of Sequences: 336 Number of extensions: 2543 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12468463 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -