BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0535.Seq (698 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U13642-8|AAG00040.1| 428|Caenorhabditis elegans Similar to tran... 29 2.4 U13642-7|AAZ32791.1| 446|Caenorhabditis elegans Similar to tran... 29 2.4 >U13642-8|AAG00040.1| 428|Caenorhabditis elegans Similar to transporter of divalentcations protein 1, isoform a protein. Length = 428 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 433 CS*VLTREVRFTVYPLATLLSFVTSRTSPPHV 528 C +L+ V T+YPL+T + +T+PPH+ Sbjct: 229 CCLLLSVAVFSTMYPLSTYTGMILLQTTPPHL 260 >U13642-7|AAZ32791.1| 446|Caenorhabditis elegans Similar to transporter of divalentcations protein 1, isoform b protein. Length = 446 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 433 CS*VLTREVRFTVYPLATLLSFVTSRTSPPHV 528 C +L+ V T+YPL+T + +T+PPH+ Sbjct: 247 CCLLLSVAVFSTMYPLSTYTGMILLQTTPPHL 278 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,008,687 Number of Sequences: 27780 Number of extensions: 172130 Number of successful extensions: 284 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 283 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 284 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -