BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0533.Seq (748 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 32 0.004 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 26 0.28 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 21 7.9 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 32.3 bits (70), Expect = 0.004 Identities = 13/36 (36%), Positives = 24/36 (66%) Frame = +2 Query: 401 TSLRDPAFYQLYNRIVEYIVEFKQYLKPYTQDKLYF 508 T++RDP FY+ ++ I + E+K L YT+++L + Sbjct: 392 TAMRDPIFYRWHSYIDDIFQEYKATLPRYTENQLNY 427 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 26.2 bits (55), Expect = 0.28 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 Query: 407 LRDPAFYQLYNRIVEYIVEFKQYLKPYTQDKLYF 508 LRDP F++ + I + EFK L YT +L + Sbjct: 394 LRDPLFFRWHAYIDDMFQEFKATLPRYTVAQLNY 427 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 633 SMDVVVLNLLFTKVHAVAGVEFKVLE 556 S DV+ LLF + +GV F+ +E Sbjct: 155 SQDVIANVLLFIFIVVKSGVAFQTIE 180 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,706 Number of Sequences: 336 Number of extensions: 3429 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -