BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0526.Seq (645 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 2.2 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 2.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.7 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.0 bits (47), Expect = 2.2 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +3 Query: 468 LLSGSRPETANRSHTPRPETLPMNQGCGWRNPDGRCFP 581 +LS + A HTP P++ G G+R+P P Sbjct: 176 ILSPEMSQVAASWHTP--SMYPLSPGAGFRSPYPSALP 211 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.0 bits (47), Expect = 2.2 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +3 Query: 468 LLSGSRPETANRSHTPRPETLPMNQGCGWRNPDGRCFP 581 +LS + A HTP P++ G G+R+P P Sbjct: 68 ILSPEMSQVAASWHTP--SMYPLSPGAGFRSPYPSALP 103 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 8.7 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +1 Query: 358 CVNYYLCN 381 C YYLCN Sbjct: 2249 CAQYYLCN 2256 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,426 Number of Sequences: 336 Number of extensions: 3077 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16552695 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -