BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0524.Seq (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. 24 3.2 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 7.5 >AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. Length = 438 Score = 24.2 bits (50), Expect = 3.2 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = -3 Query: 545 LKSGLT--VWWFSGTILFTPTMSCFDTEGE 462 LK+ LT + F ++FTP SC DT G+ Sbjct: 259 LKADLTACIADFGLALVFTPGKSCGDTHGQ 288 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.0 bits (47), Expect = 7.5 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = -1 Query: 475 TPRVKASKACSRV*PFLEIPASNSPVPAATMSTAQSA*EVP 353 T R AS S P IPA + PVPA QS +P Sbjct: 354 TSRPVASGPTSHYYPS-HIPAGSQPVPAVVNPHQQSRPTIP 393 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 579,652 Number of Sequences: 2352 Number of extensions: 10917 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -