BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0523.Seq (648 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5WLI8 Cluster: Cation-transporting ATPase; n=1; Bacill... 40 0.039 UniRef50_UPI00006CB0AF Cluster: hypothetical protein TTHERM_0024... 34 3.4 >UniRef50_Q5WLI8 Cluster: Cation-transporting ATPase; n=1; Bacillus clausii KSM-K16|Rep: Cation-transporting ATPase - Bacillus clausii (strain KSM-K16) Length = 862 Score = 40.3 bits (90), Expect = 0.039 Identities = 20/79 (25%), Positives = 38/79 (48%) Frame = +3 Query: 108 FKIVLEYLSNRNMNKFYCCFIGIS*TPFHSAYLVTHTMTKFHNYILAFCFKL*KLITIVI 287 +K + NR+MN +G S F+S YL ++ + N++ ++ + IV+ Sbjct: 205 YKSAYSAIKNRSMNMDVLVALGTSAAYFYSVYLAFQSLATYTNHVRLLDIEIILAMVIVV 264 Query: 288 PIFMVQIMFSWK*WNYDFL 344 F + + + K W+YD L Sbjct: 265 GFFALYMGITQKKWSYDLL 283 >UniRef50_UPI00006CB0AF Cluster: hypothetical protein TTHERM_00242290; n=1; Tetrahymena thermophila SB210|Rep: hypothetical protein TTHERM_00242290 - Tetrahymena thermophila SB210 Length = 191 Score = 33.9 bits (74), Expect = 3.4 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +1 Query: 352 NNASDKFVFLKFYIHMTVILNDDETFISKQLNSFQHSHEILFKNTP 489 NN+S + H+ + LN DE +SK + SF + + + FK+ P Sbjct: 78 NNSSQEIELSNNTPHLPIYLNQDENEVSKTIQSFSNQNILRFKDFP 123 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 554,855,031 Number of Sequences: 1657284 Number of extensions: 10120353 Number of successful extensions: 20148 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20128 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48955894634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -