BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0523.Seq (648 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC887.19 |rft1||human RFT1 ortholog |Schizosaccharomyces pombe... 28 1.3 SPBC15C4.06c ||SPBC21H7.01c|ubiquitin-protein ligase E3 |Schizos... 25 7.1 >SPBC887.19 |rft1||human RFT1 ortholog |Schizosaccharomyces pombe|chr 2|||Manual Length = 527 Score = 27.9 bits (59), Expect = 1.3 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +1 Query: 28 YRGSTRVLHFFFVNLAFQLMSKYKLMFLKLYWSIFQIEI 144 ++GS+R+L FF L +L S F +++ I Q I Sbjct: 21 FQGSSRILTFFLNQLTIRLTSPSAYAFSSIHFEILQSTI 59 >SPBC15C4.06c ||SPBC21H7.01c|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 556 Score = 25.4 bits (53), Expect = 7.1 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = +1 Query: 379 LKFYIHM--TVILNDDETFISKQLNSFQHSHEILFKNTP 489 + FY H TV+LN+ +SK N+F+ I++K TP Sbjct: 200 VSFYFHSDNTVLLNEYYKSLSKLKNNFR---GIIYKTTP 235 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,491,372 Number of Sequences: 5004 Number of extensions: 49076 Number of successful extensions: 93 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 91 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 291768710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -