BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0523.Seq (648 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_02_0146 + 8779249-8780130,8780815-8780970,8781070-8781265,878... 27 9.7 05_03_0366 - 13102147-13102281,13102560-13102739,13102791-131029... 27 9.7 >11_02_0146 + 8779249-8780130,8780815-8780970,8781070-8781265, 8781574-8781599 Length = 419 Score = 27.5 bits (58), Expect = 9.7 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +1 Query: 409 LNDDETFIS-KQLNSFQHSHEILFKNTP*LLCA*SSFLTFSIA 534 +ND ++F S +QLN F H + K TP +C SF +A Sbjct: 64 INDVDSFYSVQQLNKFVHHLLLHRKRTPLYVCELDSFRNGEVA 106 >05_03_0366 - 13102147-13102281,13102560-13102739,13102791-13102992, 13104385-13104575 Length = 235 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 592 LAANRRQNVPTPYKFELTFTLSRTLKNSTKH 500 + ANRRQN+ TP LT TL + +H Sbjct: 192 MVANRRQNMLTPMTQMLTSTLQQASVEGLRH 222 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,695,813 Number of Sequences: 37544 Number of extensions: 233013 Number of successful extensions: 409 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 402 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 408 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -