BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0521.Seq (548 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50378| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 78 4e-15 SB_18652| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 75 4e-14 SB_34617| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_6621| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_36687| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_47199| Best HMM Match : ATP-gua_PtransN (HMM E-Value=9.6e-15) 32 0.27 SB_58909| Best HMM Match : Renin_r (HMM E-Value=1.6e-05) 29 3.3 SB_53672| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_35966| Best HMM Match : CpaB (HMM E-Value=3.6) 28 4.4 SB_35368| Best HMM Match : UIM (HMM E-Value=6.3e-06) 28 4.4 SB_48991| Best HMM Match : Rad52_Rad22 (HMM E-Value=5.2e-12) 28 5.8 SB_33669| Best HMM Match : EMP70 (HMM E-Value=3.9e-11) 28 5.8 SB_29813| Best HMM Match : Dynein_heavy (HMM E-Value=0) 28 5.8 SB_20979| Best HMM Match : ATP-gua_PtransN (HMM E-Value=5.6e-08) 28 5.8 SB_3503| Best HMM Match : Rad52_Rad22 (HMM E-Value=1e-24) 28 5.8 SB_41260| Best HMM Match : DUF1081 (HMM E-Value=1.4) 28 5.8 SB_35674| Best HMM Match : SH2 (HMM E-Value=0) 28 5.8 SB_24839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_8314| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 28 5.8 SB_8138| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) 28 5.8 SB_31879| Best HMM Match : Exo_endo_phos (HMM E-Value=1.4) 27 7.6 SB_31222| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_25245| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_20284| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_13715| Best HMM Match : Peptidase_A17 (HMM E-Value=3.6e-10) 27 7.6 SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_38561| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4) 27 7.6 SB_35013| Best HMM Match : Exo_endo_phos (HMM E-Value=0.027) 27 7.6 SB_26005| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_20596| Best HMM Match : DUF1237 (HMM E-Value=6.4) 27 7.6 SB_12999| Best HMM Match : Exo_endo_phos (HMM E-Value=1.8e-10) 27 7.6 SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) 27 7.6 >SB_50378| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 969 Score = 78.2 bits (184), Expect = 4e-15 Identities = 39/70 (55%), Positives = 50/70 (71%), Gaps = 1/70 (1%) Frame = +2 Query: 47 VDAATLEKLEAGFSK-LQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVENL 223 ++ A +E+ F + L+ + KSLLKKYLT +VF+SLK KKTS G+ L DCI SGV NL Sbjct: 614 IERAAIEEAHLKFPEDLKKPEVKSLLKKYLTEDVFNSLKEKKTSRGAGLYDCINSGVVNL 673 Query: 224 DSGVGIYAPD 253 DSG G+YA D Sbjct: 674 DSGTGVYAAD 683 Score = 77.8 bits (183), Expect = 5e-15 Identities = 41/81 (50%), Positives = 50/81 (61%) Frame = +2 Query: 11 DGCSSARKAATMVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTL 190 D + +K + AA K L+ + KSL+KKYLT E+F+ LK+KKT G TL Sbjct: 171 DMYNGVKKLLEIEKAAVEAKRNVFPEVLKKPEVKSLMKKYLTEEMFNELKDKKTELGVTL 230 Query: 191 LDCIQSGVENLDSGVGIYAPD 253 DCI SGVENLDSG GIYA D Sbjct: 231 SDCINSGVENLDSGTGIYAGD 251 Score = 41.9 bits (94), Expect = 3e-04 Identities = 25/78 (32%), Positives = 34/78 (43%) Frame = +1 Query: 259 SYSVFAXLFDPIIEDYHNGFKKTDKHPPKNLGDVDKLGTLNPAANSWAPTAFASGGRSKG 438 SY +FA LFD IIEDYH +K KH + + L+P + T KG Sbjct: 254 SYKLFAPLFDKIIEDYHAPYKLEQKHTSDMNPEKVEAPDLDPEGSFIRSTRIRVARNLKG 313 Query: 439 TPLIPCLTSPNTKRLKTK 492 L P L+ ++ K Sbjct: 314 YALTPALSKKARLEIEEK 331 Score = 39.9 bits (89), Expect = 0.001 Identities = 18/44 (40%), Positives = 28/44 (63%) Frame = +3 Query: 363 QAGNLEPGGEFLGSNRVRFGRSLQGDPFNPLLNESQYKEIEDKV 494 +A +L+P G F+ S R+R R+L+G P L++ EIE+KV Sbjct: 289 EAPDLDPEGSFIRSTRIRVARNLKGYALTPALSKKARLEIEEKV 332 Score = 37.5 bits (83), Expect = 0.007 Identities = 19/53 (35%), Positives = 29/53 (54%) Frame = +3 Query: 366 AGNLEPGGEFLGSNRVRFGRSLQGDPFNPLLNESQYKEIEDKVFGNLLTSKGN 524 A NL+ G F+ S R+R R+L+G P L + ++E KV G L + G+ Sbjct: 722 APNLDAEGAFIRSTRIRVARNLKGYALTPGLTRKERVDVESKVVGVLNSLTGD 774 Score = 36.7 bits (81), Expect = 0.012 Identities = 28/82 (34%), Positives = 36/82 (43%), Gaps = 2/82 (2%) Frame = +1 Query: 262 YSVFAXLFDPIIEDYHNGFKKTDKHPPKNLGDVDKLGTLNPAANS--WAPTAFASGGRSK 435 Y VF LFD IIEDYH +K + H K+ D +K+ N A T K Sbjct: 687 YEVFGELFDKIIEDYHAPYKLEENH--KSDMDPEKVDAPNLDAEGAFIRSTRIRVARNLK 744 Query: 436 GTPLIPCLTSPNTKRLKTKSSG 501 G L P LT +++K G Sbjct: 745 GYALTPGLTRKERVDVESKVVG 766 >SB_18652| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 725 Score = 74.9 bits (176), Expect = 4e-14 Identities = 38/73 (52%), Positives = 51/73 (69%), Gaps = 1/73 (1%) Frame = +2 Query: 32 KAATMVDAATLEKLEAGFSK-LQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQS 208 K+ ++ A +EK + F + L + KSLLKKYLT E+F+SLK+KKT+ G +L DCI S Sbjct: 337 KSLLEIERAAIEKQRSVFPEALNKEECKSLLKKYLTAEMFNSLKDKKTAKGISLYDCINS 396 Query: 209 GVENLDSGVGIYA 247 GV NLDS G+YA Sbjct: 397 GVVNLDSSCGVYA 409 Score = 41.1 bits (92), Expect = 6e-04 Identities = 25/78 (32%), Positives = 33/78 (42%) Frame = +1 Query: 259 SYSVFAXLFDPIIEDYHNGFKKTDKHPPKNLGDVDKLGTLNPAANSWAPTAFASGGRSKG 438 SYS+F+ LFD I+E YH +K DKH + L+P T KG Sbjct: 441 SYSLFSPLFDKIVEHYHAPYKLADKHTSDMNPEKVTAPNLDPDGVFIRSTRIRVARNLKG 500 Query: 439 TPLIPCLTSPNTKRLKTK 492 L P LT ++ K Sbjct: 501 YALTPGLTRKERNEIEKK 518 Score = 39.9 bits (89), Expect = 0.001 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = +1 Query: 259 SYSVFAXLFDPIIEDYHNGFKKTDKH 336 SY+VFA LFD +IEDYH+ +K D H Sbjct: 94 SYTVFAPLFDKVIEDYHSPYKLKDGH 119 Score = 39.9 bits (89), Expect = 0.001 Identities = 21/53 (39%), Positives = 29/53 (54%) Frame = +3 Query: 366 AGNLEPGGEFLGSNRVRFGRSLQGDPFNPLLNESQYKEIEDKVFGNLLTSKGN 524 A NL+P G F+ S R+R R+L+G P L + EIE KV L + G+ Sbjct: 477 APNLDPDGVFIRSTRIRVARNLKGYALTPGLTRKERNEIEKKVTEVLCSLTGD 529 Score = 38.7 bits (86), Expect = 0.003 Identities = 24/51 (47%), Positives = 28/51 (54%), Gaps = 5/51 (9%) Frame = +2 Query: 44 MVDAATLEKLEAGFS-----KLQGSDSKSLLKKYLTREVFDSLKNKKTSFG 181 M DAA EK + + K + K LLKKYLT +VFD LK KKT G Sbjct: 8 MADAAEAEKYRSKNAYPVPLKSAKCNPKCLLKKYLTNQVFDQLKTKKTKRG 58 Score = 29.1 bits (62), Expect = 2.5 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +3 Query: 357 R*QAGNLEPGGEFLGSNRVRFGRSLQGDPFNPLLNESQYKEIEDKVFGNLLTSKGN 524 R A +L+P F+ S R+R GR L G + PL + E V + L KG+ Sbjct: 127 RVNAPDLDPDNRFIRSTRIRVGRDLAG-KYYPLTGMDEVTR-EQLVNDHFLFKKGD 180 >SB_34617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 50.8 bits (116), Expect = 7e-07 Identities = 20/26 (76%), Positives = 23/26 (88%) Frame = +1 Query: 259 SYSVFAXLFDPIIEDYHNGFKKTDKH 336 SY VFA LFDP+IE+ HNG+KKTDKH Sbjct: 455 SYDVFADLFDPVIEERHNGYKKTDKH 480 Score = 28.3 bits (60), Expect = 4.4 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 4/49 (8%) Frame = +2 Query: 119 LKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN----LDSGVGIYAPD 253 + ++L+ ++ LK+K T G TL IQ+GV+N S VG+ A D Sbjct: 404 MARHLSPRLYTKLKDKVTPNGYTLDMAIQTGVDNPGHPFISTVGLVAGD 452 >SB_6621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 50.8 bits (116), Expect = 7e-07 Identities = 31/82 (37%), Positives = 38/82 (46%) Frame = +1 Query: 259 SYSVFAXLFDPIIEDYHNGFKKTDKHPPKNLGDVDKLGTLNPAANSWAPTAFASGGRSKG 438 SY+VFA LFD +IEDYH+ +K D H D L+P T G KG Sbjct: 233 SYTVFAPLFDKVIEDYHSPYKLKDGHTSDMNPDRVNAPDLDPDNRFIRSTRIRVGRNLKG 292 Query: 439 TPLIPCLTSPNTKRLKTKSSGT 504 L P LT L+ K+S T Sbjct: 293 YGLAPSLTKKERVELEKKASFT 314 Score = 37.5 bits (83), Expect = 0.007 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = +2 Query: 110 KSLLKKYLTREVFDSLKNKKTSFG 181 K LLKKYLT +VFD LK KKT G Sbjct: 174 KCLLKKYLTNQVFDQLKTKKTKRG 197 >SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 775 Score = 46.8 bits (106), Expect = 1e-05 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = +1 Query: 259 SYSVFAXLFDPIIEDYHNGFKKTDKH 336 SY FA LFDP+IE+ H+GFKK+DKH Sbjct: 114 SYDTFAELFDPVIEERHSGFKKSDKH 139 Score = 33.1 bits (72), Expect = 0.15 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 4/51 (7%) Frame = +2 Query: 113 SLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN----LDSGVGIYAPD 253 +L+ K+LT ++ L++K T G TL IQ+GV+N S VG+ A D Sbjct: 61 NLMAKHLTPRLYVKLRDKSTPNGYTLDQAIQTGVDNPGHPFISTVGLVAGD 111 >SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2672 Score = 46.4 bits (105), Expect = 2e-05 Identities = 23/42 (54%), Positives = 26/42 (61%) Frame = +1 Query: 259 SYSVFAXLFDPIIEDYHNGFKKTDKHPPKNLGDVDKLGTLNP 384 SY VFA L DP+IE H G+KKTDKH D K G L+P Sbjct: 2374 SYDVFAELLDPVIELRHGGYKKTDKHKTDLNPDNLKGGALDP 2415 Score = 38.3 bits (85), Expect = 0.004 Identities = 17/34 (50%), Positives = 25/34 (73%) Frame = +2 Query: 119 LKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN 220 + K LT+E++ SL++K T G TL D IQ+GV+N Sbjct: 2323 MAKVLTKEIYRSLRDKSTKNGFTLDDIIQTGVDN 2356 >SB_36687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1115 Score = 45.6 bits (103), Expect = 3e-05 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = +1 Query: 259 SYSVFAXLFDPIIEDYHNGFKKTDKH 336 SY VFA +FDP+IE HNG+KKT KH Sbjct: 421 SYDVFADMFDPVIEKRHNGYKKTAKH 446 Score = 43.2 bits (97), Expect = 1e-04 Identities = 16/26 (61%), Positives = 21/26 (80%) Frame = +1 Query: 259 SYSVFAXLFDPIIEDYHNGFKKTDKH 336 SY VFA +FDP+IE H+G++KTD H Sbjct: 52 SYDVFADMFDPVIEKRHDGYRKTDMH 77 Score = 39.9 bits (89), Expect = 0.001 Identities = 24/71 (33%), Positives = 41/71 (57%), Gaps = 1/71 (1%) Frame = +2 Query: 11 DGCSSARKAATMVDAATLEKLEAGFSKLQGSD-SKSLLKKYLTREVFDSLKNKKTSFGST 187 + S AR+ A +A +K + ++ G + ++ + K+LTR+V++ L N KT G T Sbjct: 731 ESVSKAREEAIKKEAER-QKASSTLRRVPGPEQAQHYMAKFLTRDVYNKLCNLKTPSGFT 789 Query: 188 LLDCIQSGVEN 220 L IQ+GV+N Sbjct: 790 LDGVIQTGVDN 800 Score = 36.7 bits (81), Expect = 0.012 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +1 Query: 259 SYSVFAXLFDPIIEDYHNGFKKTDKH 336 +Y VFA L DP+IE HNG+ K KH Sbjct: 818 TYKVFAALLDPVIEARHNGYLKGAKH 843 Score = 31.1 bits (67), Expect = 0.62 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +2 Query: 119 LKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN 220 + K +T++V+ L N +T G TL IQ+GV+N Sbjct: 1 MAKCMTKDVYQRLSNLRTPSGYTLDMAIQTGVDN 34 >SB_47199| Best HMM Match : ATP-gua_PtransN (HMM E-Value=9.6e-15) Length = 132 Score = 32.3 bits (70), Expect = 0.27 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = +2 Query: 113 SLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSGVEN 220 +++ ++LT E++ L ++KTS G TL IQ GV+N Sbjct: 77 NIMARHLTPEMYVHLCDRKTSNGFTLDQAIQPGVDN 112 >SB_58909| Best HMM Match : Renin_r (HMM E-Value=1.6e-05) Length = 385 Score = 28.7 bits (61), Expect = 3.3 Identities = 21/65 (32%), Positives = 31/65 (47%) Frame = +2 Query: 32 KAATMVDAATLEKLEAGFSKLQGSDSKSLLKKYLTREVFDSLKNKKTSFGSTLLDCIQSG 211 KAA + + L KL AG++ L D+ L + LT E LK K S + +Q Sbjct: 195 KAAVQLLKSVLPKLTAGYADLYHGDA---LVEVLTTEWHGDLKEKYPQDVSGIYQLVQGQ 251 Query: 212 VENLD 226 +E+ D Sbjct: 252 LESRD 256 >SB_53672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 675 Score = 28.7 bits (61), Expect = 3.3 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = -2 Query: 517 LEVNRFPKTLSSISLYWDSLSKGLKGSPWSDRPKRTRLEPRNSPPGS 377 L VN+FP LS+ + + + L+G P P++SPP S Sbjct: 288 LGVNQFPPFLSNFNTDQFMMKESLRGMPDGSSSTEGSTTPKSSPPFS 334 >SB_35966| Best HMM Match : CpaB (HMM E-Value=3.6) Length = 277 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/40 (37%), Positives = 28/40 (70%) Frame = -2 Query: 163 VLQAVEYFPGKVLLQQRLRVGSLELAETSLQFLEGCGVDH 44 + +AV P +V+L R+++GS +LA+ L+ L+G G++H Sbjct: 204 ITRAVIDGPLRVVL--RVQIGSCDLADEHLRKLDGGGLEH 241 >SB_35368| Best HMM Match : UIM (HMM E-Value=6.3e-06) Length = 362 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -3 Query: 237 PTPESKFSTPDWMQSRRVDPNEVFLFFRLSNTS 139 P P+ KFS P + SR +D E L F L+ S Sbjct: 5 PKPKEKFSEPVIIASRNLDSVEARLAFNLTTVS 37 >SB_48991| Best HMM Match : Rad52_Rad22 (HMM E-Value=5.2e-12) Length = 353 Score = 27.9 bits (59), Expect = 5.8 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 74 EAGFSKLQGSDSKSL-LKKYLTREVFDSLKNKKTSFGSTLLDCI 202 + G+ +G SK+L L+K V D LK +FG L +C+ Sbjct: 30 DVGYGVSEGMKSKALSLEKARKEAVTDGLKRALKNFGQALGNCV 73 >SB_33669| Best HMM Match : EMP70 (HMM E-Value=3.9e-11) Length = 809 Score = 27.9 bits (59), Expect = 5.8 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 198 QSRRVDPNEVFLFFRLSNTSLVRYFFSSDLESDPWSLL 85 Q R D N V++ +R L F DL+ PWS+L Sbjct: 65 QDRAADKNHVYISYR-DCKKLDEEAFPEDLDEAPWSVL 101 >SB_29813| Best HMM Match : Dynein_heavy (HMM E-Value=0) Length = 659 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 459 NESQYKEIEDKVFGNLLTSKGN 524 N+ Q KEIEDK+ L +S+GN Sbjct: 116 NKKQLKEIEDKILEVLSSSEGN 137 >SB_20979| Best HMM Match : ATP-gua_PtransN (HMM E-Value=5.6e-08) Length = 322 Score = 27.9 bits (59), Expect = 5.8 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +3 Query: 402 SNRVRFGRSLQGDPFNPLLNESQYKEIEDKVFGNLLTSKG 521 S RVR RSLQG PF + + ++ +EI++ V L + KG Sbjct: 282 SCRVRVVRSLQGFPFAWVCSPNERREIQNVVKQALDSLKG 321 >SB_3503| Best HMM Match : Rad52_Rad22 (HMM E-Value=1e-24) Length = 398 Score = 27.9 bits (59), Expect = 5.8 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 74 EAGFSKLQGSDSKSL-LKKYLTREVFDSLKNKKTSFGSTLLDCI 202 + G+ +G SK+L L+K V D LK +FG L +C+ Sbjct: 75 DVGYGVSEGMKSKALSLEKARKEAVTDGLKRALKNFGQALGNCV 118 >SB_41260| Best HMM Match : DUF1081 (HMM E-Value=1.4) Length = 617 Score = 27.9 bits (59), Expect = 5.8 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 9 LTVVQVPEKPQQWSTPQPSRNWRLVSASSRDPTLS 113 LT V+VP+ Q +T RN + S+S+ DP L+ Sbjct: 534 LTAVEVPKPGDQDTTLDKERNNSVTSSSTPDPPLT 568 >SB_35674| Best HMM Match : SH2 (HMM E-Value=0) Length = 871 Score = 27.9 bits (59), Expect = 5.8 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +1 Query: 352 GDVDKLGTLNPAANSWAPTAFASGGRSKGTPLIP 453 G++ KL T NP A P + G SKG P P Sbjct: 806 GNLPKLPTANPDAPPPLPLTYGVGSMSKGPPPRP 839 >SB_24839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.9 bits (59), Expect = 5.8 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 9 LTVVQVPEKPQQWSTPQPSRNWRLVSASSRDPTLS 113 LT V+VP+ Q +T RN + S+S+ DP L+ Sbjct: 70 LTAVEVPKPGDQDTTLDKERNNSVTSSSTPDPPLT 104 >SB_8314| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 309 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +1 Query: 259 SYSVFAXLFDPIIEDYHNGFK-KTDKH 336 SY F + P+I+ YH GF T KH Sbjct: 10 SYDDFKDFYYPVIQAYHKGFDINTSKH 36 >SB_8138| Best HMM Match : ATP-gua_Ptrans (HMM E-Value=0) Length = 383 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +1 Query: 259 SYSVFAXLFDPIIEDYHNGFK-KTDKH 336 SY F + P+I+ YH GF T KH Sbjct: 102 SYDDFKDFYYPVIQAYHKGFDINTSKH 128 >SB_31879| Best HMM Match : Exo_endo_phos (HMM E-Value=1.4) Length = 200 Score = 27.5 bits (58), Expect = 7.6 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 198 QSRRVDPNEVFLFFRLSNTSLVRYFFSSDLESDPWSLL 85 Q R D N V++ +R L F DL+ PWS+L Sbjct: 145 QDRAADKNHVYISYR-DCKKLDEEAFLKDLDEAPWSVL 181 >SB_31222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 367 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 441 PFNPLLNESQYKEIEDKVFGNLLTSKGN 524 PFN L E + K+IEDK N + ++ N Sbjct: 166 PFNEPLTEEELKDIEDKNKKNAIAAREN 193 >SB_25245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 27.5 bits (58), Expect = 7.6 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 198 QSRRVDPNEVFLFFRLSNTSLVRYFFSSDLESDPWSLL 85 Q R D N V++ +R L F DL+ PWS+L Sbjct: 101 QDRAADKNHVYISYR-DCKKLDEEAFLKDLDEAPWSVL 137 >SB_20284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3307 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 459 NESQYKEIEDKVFGNLLTSKGN 524 N+ Q KEIEDK+ L +S+GN Sbjct: 2151 NKRQLKEIEDKILEVLSSSEGN 2172 >SB_13715| Best HMM Match : Peptidase_A17 (HMM E-Value=3.6e-10) Length = 596 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -3 Query: 405 WSPGIRRRVQGSQLVNVSQVLGRVLVGLLEAIVVVLD 295 W G R+R+ G + +VLGR + L+ VV++ Sbjct: 447 WYGGFRKRLIGLTKTTLKKVLGRASINLVTLQTVVME 483 >SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 893 Score = 27.5 bits (58), Expect = 7.6 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 198 QSRRVDPNEVFLFFRLSNTSLVRYFFSSDLESDPWSLL 85 Q R D N V++ +R L F DL+ PWS+L Sbjct: 337 QDRAADKNHVYISYR-DCKKLDEEAFLKDLDEAPWSVL 373 >SB_38561| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4) Length = 432 Score = 27.5 bits (58), Expect = 7.6 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 198 QSRRVDPNEVFLFFRLSNTSLVRYFFSSDLESDPWSLL 85 Q R D N V++ +R L F DL+ PWS+L Sbjct: 145 QDRAADKNHVYISYR-DCKKLDEEAFLKDLDEAPWSVL 181 >SB_35013| Best HMM Match : Exo_endo_phos (HMM E-Value=0.027) Length = 381 Score = 27.5 bits (58), Expect = 7.6 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 198 QSRRVDPNEVFLFFRLSNTSLVRYFFSSDLESDPWSLL 85 Q R D N V++ +R L F DL+ PWS+L Sbjct: 189 QDRAADKNHVYISYR-DCKKLDEEAFLKDLDEAPWSVL 225 >SB_26005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 947 Score = 27.5 bits (58), Expect = 7.6 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 198 QSRRVDPNEVFLFFRLSNTSLVRYFFSSDLESDPWSLL 85 Q R D N V++ +R L F DL+ PWS+L Sbjct: 101 QDRAADKNHVYISYR-DCKKLDEEAFLKDLDEAPWSVL 137 >SB_20596| Best HMM Match : DUF1237 (HMM E-Value=6.4) Length = 526 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 448 LKGSPWSDRPKRTRLEPRNSPP 383 L+G P RP TRL+ RNS P Sbjct: 273 LEGDPEQPRPPATRLQGRNSNP 294 >SB_12999| Best HMM Match : Exo_endo_phos (HMM E-Value=1.8e-10) Length = 734 Score = 27.5 bits (58), Expect = 7.6 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 198 QSRRVDPNEVFLFFRLSNTSLVRYFFSSDLESDPWSLL 85 Q R D N V++ +R L F DL+ PWS+L Sbjct: 605 QDRAADKNHVYISYR-DCKKLDEEAFLKDLDEAPWSVL 641 >SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) Length = 675 Score = 27.5 bits (58), Expect = 7.6 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 198 QSRRVDPNEVFLFFRLSNTSLVRYFFSSDLESDPWSLL 85 Q R D N V++ +R L F DL+ PWS+L Sbjct: 119 QDRAADKNHVYISYR-DCKKLDEEAFLKDLDEAPWSVL 155 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,087,341 Number of Sequences: 59808 Number of extensions: 334652 Number of successful extensions: 1092 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 994 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1091 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -