BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0520.Seq (606 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 45 2e-06 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 3.3 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 45.2 bits (102), Expect = 2e-06 Identities = 31/93 (33%), Positives = 40/93 (43%), Gaps = 1/93 (1%) Frame = +2 Query: 128 MRECISVHVGQAGVQMGVACWQLYCLEHGIRPDGTLPACETDLIQRI-PASIRFFLRLIE 304 MRECISVHVGQAGVQ+G CW C + + T+ T + + S RL + Sbjct: 1 MRECISVHVGQAGVQIGNPCWD--CTVWSMASNRTVRCPRTRRSEAVMTRSTPSSPRLAQ 58 Query: 305 GXXXXXXXXXXXXXXXXTKFVPANTANCITLHS 403 + PA TA+C T S Sbjct: 59 ASTCPVPCSSIWSRPSSMRCAPARTASCSTRSS 91 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 24.2 bits (50), Expect = 3.3 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -2 Query: 185 TRRPSGPRLGPR 150 T RPSGP +GPR Sbjct: 1144 TFRPSGPAMGPR 1155 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 554,401 Number of Sequences: 2352 Number of extensions: 10221 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58870980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -