BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0518.Seq (648 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49859| Best HMM Match : No HMM Matches (HMM E-Value=.) 128 5e-30 SB_8772| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_34186| Best HMM Match : Cyt-b5 (HMM E-Value=2.6e-13) 69 4e-12 SB_42543| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_10760| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_47817| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_59748| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_6989| Best HMM Match : LRR_1 (HMM E-Value=0.074) 31 0.61 SB_5506| Best HMM Match : rve (HMM E-Value=0.00062) 31 0.61 SB_1513| Best HMM Match : DUF1472 (HMM E-Value=2.9) 31 0.61 SB_20151| Best HMM Match : rve (HMM E-Value=2.9e-12) 31 0.61 SB_9088| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_49575| Best HMM Match : Laminin_G_2 (HMM E-Value=4.2) 31 1.1 SB_15622| Best HMM Match : Pec_lyase_N (HMM E-Value=2.9) 31 1.1 SB_38937| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_1255| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_50079| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_16593| Best HMM Match : rve (HMM E-Value=9.3e-16) 30 1.9 SB_8469| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_19980| Best HMM Match : rve (HMM E-Value=0.91) 29 2.5 SB_55326| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_51132| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_27476| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_3855| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_2270| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_45056| Best HMM Match : rve (HMM E-Value=7.2e-19) 29 3.3 SB_23584| Best HMM Match : RVT_1 (HMM E-Value=0.0029) 29 3.3 SB_27589| Best HMM Match : rve (HMM E-Value=1.5e-11) 29 4.3 SB_41457| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_2258| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_58507| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_23071| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_37084| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_35802| Best HMM Match : Laminin_EGF (HMM E-Value=0.25) 28 7.5 SB_22903| Best HMM Match : 7tm_1 (HMM E-Value=3.2e-05) 27 9.9 SB_52158| Best HMM Match : rve (HMM E-Value=5.9e-07) 27 9.9 SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_21867| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_49859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 128 bits (308), Expect = 5e-30 Identities = 62/102 (60%), Positives = 76/102 (74%), Gaps = 2/102 (1%) Frame = +1 Query: 262 RKDMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATF 441 ++D T EL++YDG + VLMAVNG +FDVTRG FYGPGGPY+ F G DA+RGLATF Sbjct: 58 KRDFTLDELKEYDGLKSP-YVLMAVNGKVFDVTRGKDFYGPGGPYSNFAGHDASRGLATF 116 Query: 442 SV--TAPEKDYDDLSDLNSMEMGIMREWEEQFRENYDLVXRL 561 S+ A + +YDDLSDLN M+ +REWE+QF E YDLV RL Sbjct: 117 SLGPEAIKDEYDDLSDLNGMQQDSLREWEQQFDEKYDLVGRL 158 >SB_8772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 81.8 bits (193), Expect = 4e-16 Identities = 43/106 (40%), Positives = 61/106 (57%), Gaps = 5/106 (4%) Frame = +1 Query: 265 KDMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFS 444 ++ T EL+ YDG + + +AVNG +FDVT ++GP GP + G+DA+R L TFS Sbjct: 72 REFTVRELKGYDGVNKE-LIYVAVNGKVFDVTSAWNYFGPAGPDCLLAGKDASRALVTFS 130 Query: 445 V-----TAPEKDYDDLSDLNSMEMGIMREWEEQFRENYDLVXRLSE 567 V T DDL+DLN ++ + E+E Q+ E Y V RL E Sbjct: 131 VDNFYQTEQRDSMDDLNDLNPLQRDCLFEYETQYMERYPCVGRLVE 176 >SB_34186| Best HMM Match : Cyt-b5 (HMM E-Value=2.6e-13) Length = 310 Score = 68.5 bits (160), Expect = 4e-12 Identities = 32/97 (32%), Positives = 58/97 (59%) Frame = +1 Query: 271 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 450 ++ +L ++DG+Q + +A+ G ++DV +G RFYGPG Y VF GRD+T T + Sbjct: 88 LSTEDLAKHDGSQPDANIYIAILGKVYDVEKGRRFYGPGTGYHVFAGRDSTPSFVT-GMF 146 Query: 451 APEKDYDDLSDLNSMEMGIMREWEEQFRENYDLVXRL 561 K DD S+L + ++ ++ W E ++++Y V ++ Sbjct: 147 DRAKATDDCSNLKNEDLLGIKGWMEFYQKDYKYVGKV 183 >SB_42543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/61 (40%), Positives = 39/61 (63%) Frame = +1 Query: 271 MTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATRGLATFSVT 450 ++ V+L ++DG Q + +A+ G ++DV +G RFYGPG Y VF GRD+T T V+ Sbjct: 272 LSTVDLVKHDGLQPDANIYIAILGKVYDVEKGRRFYGPGTGYHVFAGRDSTPSFVTVLVS 331 Query: 451 A 453 + Sbjct: 332 S 332 >SB_10760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.8 bits (101), Expect = 6e-05 Identities = 26/99 (26%), Positives = 46/99 (46%) Frame = +1 Query: 247 KTTKLRKDMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRGNRFYGPGGPYAVFGGRDATR 426 K T K T EL ++G + +AV G +FDV+ YG G Y G++ +R Sbjct: 40 KITPGHKLFTKDELATFNGRNSNSPIYVAVKGVVFDVSTSKDLYGYGESYNSMAGKECSR 99 Query: 427 GLATFSVTAPEKDYDDLSDLNSMEMGIMREWEEQFRENY 543 +A +S+ A + +L+ + ++ E+ F + Y Sbjct: 100 AIAKWSLAAENMN----GNLDGLTKDELQRLEKNFHDVY 134 >SB_47817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 693 Score = 31.9 bits (69), Expect = 0.46 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQC 220 S+H EY + A +LC +LP Y + S+++ F G + + C Sbjct: 610 SNHAEYVVYRQNVVRARVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 657 >SB_59748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 420 Score = 31.5 bits (68), Expect = 0.61 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQC 220 S+H EY + +++LC +LP Y + S+++ F G + + C Sbjct: 337 SNHAEYVVYRQNVLRSSVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 384 >SB_6989| Best HMM Match : LRR_1 (HMM E-Value=0.074) Length = 180 Score = 31.5 bits (68), Expect = 0.61 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 5/65 (7%) Frame = -2 Query: 317 PPSCVPSYCRSSTAVISFRNLVVF----SREQPLNNVSYTCSKIYTVSQM-YSQKQNK*T 153 PP CV YC +S VI+ R L + P++ +S + +YT S+ +++ K Sbjct: 9 PPPCVGFYCEASPRVITIRTLNAHGWSNTATDPVSRLSLYHTSVYTQSRFDFNRAHQKMA 68 Query: 152 VDKTV 138 +KT+ Sbjct: 69 WEKTL 73 >SB_5506| Best HMM Match : rve (HMM E-Value=0.00062) Length = 390 Score = 31.5 bits (68), Expect = 0.61 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQC 220 S+H EY + +++LC +LP Y + S+++ F G + + C Sbjct: 307 SNHAEYVVYRQNVLRSSVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 354 >SB_1513| Best HMM Match : DUF1472 (HMM E-Value=2.9) Length = 317 Score = 31.5 bits (68), Expect = 0.61 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQC 220 S+H EY + + +LC +LP Y + S+++ F G + + C Sbjct: 234 SNHAEYLVYRQNVARSRVLCATLLPVVYSVSLVSRYNELFTGRSLQSC 281 >SB_20151| Best HMM Match : rve (HMM E-Value=2.9e-12) Length = 438 Score = 31.5 bits (68), Expect = 0.61 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQC 220 S+H EY + + +LC +LP Y + S+++ F G + + C Sbjct: 355 SNHAEYVVYRQNMVRSRVLCAALLPVVYSVSLDSRYNELFTGRSLQSC 402 >SB_9088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 884 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQC 220 S+H EY + + +LC +LP Y + S+++ F G + + C Sbjct: 813 SNHAEYVVYRQNVVRSRVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 860 >SB_49575| Best HMM Match : Laminin_G_2 (HMM E-Value=4.2) Length = 580 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQC 220 S+H EY + + +LC +LP Y + S+++ F G + + C Sbjct: 444 SNHAEYVVYRQNVVRSRVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 491 >SB_15622| Best HMM Match : Pec_lyase_N (HMM E-Value=2.9) Length = 511 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQC 220 S+H EY + +++LC +LP Y + S+++ F G + + C Sbjct: 330 SNHAEYVVHRQNVLRSSVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 377 >SB_38937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2085 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQCV 217 S+H EY + + LLC +L Y + S+++ F G + + CV Sbjct: 2001 SNHAEYVVYRQNVVRSRLLCATLLSVVYSVSLDSRYNELFTGRSLQSCV 2049 >SB_1255| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQC 220 S+H EY + + +LC +LP Y + S+++ F G + + C Sbjct: 150 SNHAEYVVYRQNVVRSRVLCATLLPVVYSISLDSRYNELFTGRSLQSC 197 >SB_50079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQC 220 S+H EY + +LC +LP Y + S+++ F G + + C Sbjct: 413 SNHAEYVVYRQNVVRPRVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 460 >SB_16593| Best HMM Match : rve (HMM E-Value=9.3e-16) Length = 783 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQC 220 S+H EY + +LC +LP Y + S+++ F G + + C Sbjct: 504 SNHAEYVVYRQNVVRTRVLCATLLPVVYSVSLDSRYNELFTGHSLQSC 551 >SB_8469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 874 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQC 220 S+H EY + + +LC +LP Y + S+++ F G + + C Sbjct: 786 SNHAEYVVYRQNVVRSGVLCATLLPVVYSLSLDSRYNELFTGRSLQSC 833 >SB_19980| Best HMM Match : rve (HMM E-Value=0.91) Length = 367 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQC 220 S+H EY + + +LC +LP Y + S+++ F G + + C Sbjct: 284 SNHAEYVVYCQNVVRSRVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 331 >SB_55326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1289 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQC 220 S+H EY + + +LC +LP Y + S++ F G + + C Sbjct: 1206 SNHAEYVVYRQNVVRSRVLCATLLPVVYSVSLDSRYYELFTGRSLQSC 1253 >SB_51132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/48 (25%), Positives = 23/48 (47%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQC 220 ++H EY + +LC +LP Y + S+++ F G + + C Sbjct: 159 TNHTEYVVYRQNVVRTRVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 206 >SB_27476| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 528 Score = 29.1 bits (62), Expect = 3.3 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = -2 Query: 374 NRFPLVTSNIHPFTAINTLPPSCVPSYCRSSTAVISFRNLVVFSREQPLN 225 NR P+ F ++T PP+ +YCRS V S + S E LN Sbjct: 419 NRSPIAIDGAF-FAKLSTAPPNGEATYCRSMVYVSSSVRAMYLSYESLLN 467 >SB_3855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 994 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQC 220 S+H EY + +LC +LP Y + S+++ F G + + C Sbjct: 911 SNHAEYVVYRQIVVRSRVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 958 >SB_2270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -3 Query: 220 CLILVVKFIQYHKCTHKNKINKRLTKQCF*GLKKATVFGLHI-FNLWW*IH 71 C I+ + F+QY CT + T +C +K + G+HI +L W +H Sbjct: 477 CKIMDIDFLQYRACTWRPIYVGGTTLEC---VKSFKLLGIHISSDLTWDVH 524 >SB_45056| Best HMM Match : rve (HMM E-Value=7.2e-19) Length = 479 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/48 (25%), Positives = 24/48 (50%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQC 220 S+H EY + +++LC +LP Y + S+++ G + + C Sbjct: 363 SNHAEYVVYRQNVLRSSVLCATLLPVVYSVSLDSRYNELITGRSLQSC 410 >SB_23584| Best HMM Match : RVT_1 (HMM E-Value=0.0029) Length = 511 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -3 Query: 220 CLILVVKFIQYHKCTHKNKINKRLTKQCF*GLKKATVFGLHI-FNLWW*IH 71 C I+ + F+QY CT + T +C +K + G+HI +L W +H Sbjct: 407 CKIMDIDFLQYRACTWRPIYVGGTTLEC---VKSFKLLGIHISSDLTWDVH 454 >SB_27589| Best HMM Match : rve (HMM E-Value=1.5e-11) Length = 323 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/48 (25%), Positives = 24/48 (50%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQC 220 S+H E+ + + +LC +LP Y + S+++ F G + + C Sbjct: 240 SNHAEHVVYRQNVVRSRVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 287 >SB_41457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 545 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/48 (25%), Positives = 24/48 (50%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQC 220 S+H E+ + + +LC +LP Y + S+++ F G + + C Sbjct: 462 SNHAEHVVYRQNVVRSRVLCATLLPVVYSVSLDSRYNELFTGRSLQSC 509 >SB_2258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 28.7 bits (61), Expect = 4.3 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = -2 Query: 395 YGPPGP*NRFPLVTSNIHPFTAINTLPPSCVPSYCRSSTAVISFRNLVVFSR-EQP 231 Y PP P ++ PL + +P+ N+ + V SYCR+ V + L +F+R QP Sbjct: 254 YKPPPPASQ-PLTKLDDYPYDNANS--QTAVSSYCRTFVFVAAVAYLRIFARVRQP 306 >SB_58507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2353 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFE 226 S+H EY + + LLC +LP Y + S+++ F G + + Sbjct: 140 SNHAEYVVYRQNVVRSRLLCATLLPVVYSVSLDSRYNELFTGRSLQ 185 >SB_23071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQC 220 S+H EY + + +LC +LP Y + S ++ F G + C Sbjct: 1056 SNHAEYVVYRQNVVRSRVLCATLLPVVYSVSLDSCYNELFTGRRLQSC 1103 >SB_37084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1361 Score = 27.9 bits (59), Expect = 7.5 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 3/63 (4%) Frame = -2 Query: 647 FWSSLGERTCLLLRVLRPS--SSWVLHQASESRXTRS*FSLNCSSHSLMIPISI-ELRSL 477 F ++ E LLLR +R SW LH+ S + +S++ ++S +P+ + ++R L Sbjct: 729 FLNNYIEAVSLLLRFIRAEREGSWELHRTSVNEMIPYFYSIDRINYSRWLPVYVADMRML 788 Query: 476 KSS 468 S+ Sbjct: 789 PST 791 >SB_35802| Best HMM Match : Laminin_EGF (HMM E-Value=0.25) Length = 781 Score = 27.9 bits (59), Expect = 7.5 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 3/61 (4%) Frame = -2 Query: 647 FWSSLGERTCLLLRVLRP--SSSWVLHQASESRXTRS*FSLNCSSHSLMIPISI-ELRSL 477 FW LLL+ ++ + +W LH AS + FS++ ++S +P+ I ++R L Sbjct: 245 FWMRYMSMVKLLLQFIKAERTGNWELHLASTAAMISHFFSMDRPNYSRWLPVYISDMRQL 304 Query: 476 K 474 + Sbjct: 305 E 305 >SB_22903| Best HMM Match : 7tm_1 (HMM E-Value=3.2e-05) Length = 885 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -3 Query: 373 TDSL*SHRISTHSQPSTLCHPPVSRRTAVV 284 T ++ +HR++ H+ L PPVS +T +V Sbjct: 807 TTTITNHRLNCHTNSVILSSPPVSDQTPIV 836 >SB_52158| Best HMM Match : rve (HMM E-Value=5.9e-07) Length = 367 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/48 (25%), Positives = 23/48 (47%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQC 220 S+H EY + + +LC +L Y + S+++ F G + + C Sbjct: 288 SNHAEYVVYRQNMVRSRVLCATLLLVVYSVSLDSRYNELFTGRSLQSC 335 >SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 27.5 bits (58), Expect = 9.9 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = -2 Query: 626 RTCLLLRVLRPSSSWVLHQASESRXTRS*FSLNCSSHSLMIPISIELRSLKSS 468 R C+L +L S SW + E R F + C I S +LR+ +SS Sbjct: 618 RACILSTLLYGSESWTTYARQEKRLNT--FHMRCLRRIPRIHWSDKLRNTRSS 668 >SB_21867| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 864 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/48 (25%), Positives = 23/48 (47%) Frame = -1 Query: 363 SSHIEYPPIHSHQHSATLLCPVVLP*FYCGHIFSQFSSFFKGATFEQC 220 S+H EY + + +LC +L Y + S+++ F G + + C Sbjct: 785 SNHAEYVVYRQNMVRSRVLCATLLLVVYSVSLDSRYNELFTGRSLQSC 832 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,369,450 Number of Sequences: 59808 Number of extensions: 456200 Number of successful extensions: 1271 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 1137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1264 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -