BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0516.Seq (692 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X69830-1|CAA49484.1| 590|Drosophila melanogaster ref(2)Pn prote... 55 1e-07 X69829-1|CAA49483.1| 599|Drosophila melanogaster ref(2)Po2 prot... 55 1e-07 X69828-1|CAA49482.1| 583|Drosophila melanogaster Ref(2) Pp prot... 55 1e-07 X16993-1|CAA34861.1| 599|Drosophila melanogaster Ref(2)P protei... 55 1e-07 U23933-1|AAA98841.1| 591|Drosophila melanogaster Ref(2)P protei... 55 1e-07 U23932-1|AAA98840.1| 599|Drosophila melanogaster Ref(2)P protei... 55 1e-07 U23931-1|AAA98839.1| 599|Drosophila melanogaster Ref(2)P protei... 55 1e-07 U23929-1|AAA98838.1| 599|Drosophila melanogaster Ref(2)P protei... 55 1e-07 U23928-1|AAA98837.1| 599|Drosophila melanogaster Ref(2)P protei... 55 1e-07 U23927-1|AAA98836.1| 591|Drosophila melanogaster Ref(2)P protei... 55 1e-07 U23926-1|AAA98835.1| 591|Drosophila melanogaster Ref(2)P protei... 55 1e-07 U23925-1|AAA98834.1| 590|Drosophila melanogaster Ref(2)P protei... 55 1e-07 U23924-1|AAA98833.1| 599|Drosophila melanogaster Ref(2)P protei... 55 1e-07 U23923-1|AAA98832.1| 591|Drosophila melanogaster Ref(2)P protei... 55 1e-07 AY089494-1|AAL90232.1| 599|Drosophila melanogaster GH06306p pro... 55 1e-07 AM114191-1|CAJ35082.2| 436|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114190-1|CAJ35081.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114189-1|CAJ35080.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114187-1|CAJ35078.2| 436|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114186-1|CAJ35077.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114185-1|CAJ35076.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114183-1|CAJ35074.2| 444|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114182-1|CAJ35073.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114181-1|CAJ35072.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114180-1|CAJ35071.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114179-1|CAJ35070.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114178-1|CAJ35069.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114177-1|CAJ35068.2| 436|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114176-1|CAJ35067.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114175-1|CAJ35066.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114174-1|CAJ35065.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114173-1|CAJ35064.2| 436|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114172-1|CAJ35063.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114171-1|CAJ35062.2| 436|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114170-1|CAJ35061.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114169-1|CAJ35060.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114168-1|CAJ35059.2| 436|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114167-1|CAJ35058.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114166-1|CAJ35057.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114165-1|CAJ35056.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114163-1|CAJ35054.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114162-1|CAJ35053.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114161-1|CAJ35052.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114160-1|CAJ35051.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114159-1|CAJ35050.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114158-1|CAJ35049.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114157-1|CAJ35048.2| 436|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114156-1|CAJ35047.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114155-1|CAJ35046.2| 436|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114154-1|CAJ35045.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114153-1|CAJ35044.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114152-1|CAJ35043.2| 436|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114151-1|CAJ35042.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114150-1|CAJ35041.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114149-1|CAJ35040.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114148-1|CAJ35039.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114147-1|CAJ35038.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114146-1|CAJ35037.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114145-1|CAJ35036.2| 444|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114144-1|CAJ35035.2| 436|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114143-1|CAJ35034.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114142-1|CAJ35033.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114141-1|CAJ35032.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114140-1|CAJ35031.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114139-1|CAJ35030.2| 436|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114138-1|CAJ35029.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114137-1|CAJ35028.2| 436|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114136-1|CAJ35027.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114135-1|CAJ35026.2| 436|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114134-1|CAJ35025.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114133-1|CAJ35024.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114132-1|CAJ35023.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114131-1|CAJ35022.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114130-1|CAJ35021.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114129-1|CAJ35020.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114128-1|CAJ35019.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114127-1|CAJ35018.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114126-1|CAJ35017.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114125-1|CAJ35016.2| 436|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114124-1|CAJ35015.2| 436|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114123-1|CAJ35014.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114122-1|CAJ35013.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114121-1|CAJ35012.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114119-1|CAJ35010.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114118-1|CAJ35009.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114117-1|CAJ35008.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114116-1|CAJ35007.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114115-1|CAJ35006.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114114-1|CAJ35005.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114113-1|CAJ35004.2| 436|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114112-1|CAJ35003.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114111-1|CAJ35002.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114110-1|CAJ35001.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114109-1|CAJ35000.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114108-1|CAJ34999.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114107-1|CAJ34998.2| 444|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114106-1|CAJ34997.2| 445|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114105-1|CAJ34996.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AM114104-1|CAJ34995.2| 437|Drosophila melanogaster Ref(2)P prot... 55 1e-07 AE014134-3129|AAX52671.1| 599|Drosophila melanogaster CG10360-P... 55 1e-07 AE014134-3128|AAF53824.1| 599|Drosophila melanogaster CG10360-P... 55 1e-07 AY118647-1|AAM50016.1| 1226|Drosophila melanogaster SD05267p pro... 45 1e-04 AE014296-2615|AAF49551.3| 1226|Drosophila melanogaster CG5841-PA... 45 1e-04 AM114188-2|CAJ38358.1| 300|Drosophila melanogaster Ref(2)P prot... 40 0.002 AM114184-2|CAJ38354.1| 292|Drosophila melanogaster Ref(2)P prot... 40 0.002 AM114164-2|CAJ38334.1| 300|Drosophila melanogaster Ref(2)P prot... 40 0.002 AM114120-2|CAJ38290.1| 292|Drosophila melanogaster Ref(2)P prot... 40 0.002 BT016111-1|AAV36996.1| 1049|Drosophila melanogaster LD11955p pro... 39 0.006 AE014134-3020|AAF53743.1| 1049|Drosophila melanogaster CG17492-P... 39 0.006 BT024222-1|ABC86284.1| 599|Drosophila melanogaster LP17815p pro... 39 0.007 BT001502-1|AAN71257.1| 599|Drosophila melanogaster LD34776p pro... 39 0.007 BT001483-1|AAN71238.1| 599|Drosophila melanogaster LD22379p pro... 39 0.007 AY061066-1|AAL28614.1| 599|Drosophila melanogaster LD03515p pro... 39 0.007 AE014297-858|AAF54325.2| 643|Drosophila melanogaster CG11984-PC... 39 0.007 AE014297-857|AAF54323.2| 643|Drosophila melanogaster CG11984-PB... 39 0.007 AE014297-856|AAF54324.2| 643|Drosophila melanogaster CG11984-PA... 39 0.007 BT023118-1|AAY55534.1| 221|Drosophila melanogaster IP08740p pro... 34 0.21 AL138971-5|CAB72283.1| 295|Drosophila melanogaster EG:BACR43E12... 34 0.21 AE014298-474|AAF45832.1| 215|Drosophila melanogaster CG3526-PA,... 34 0.21 AE014298-473|AAN09090.1| 294|Drosophila melanogaster CG3526-PB,... 34 0.21 AE013599-2072|AAM70976.1| 733|Drosophila melanogaster CG30471-P... 34 0.21 BT010020-1|AAQ22489.1| 1051|Drosophila melanogaster RE11449p pro... 33 0.28 AY875639-1|AAX59985.1| 1854|Drosophila melanogaster Dp205 protein. 33 0.28 AY128502-1|AAM75095.1| 706|Drosophila melanogaster SD03660p pro... 33 0.28 AF297644-1|AAK15256.1| 3497|Drosophila melanogaster dystrophin-l... 33 0.28 AF277386-1|AAG17395.1| 3127|Drosophila melanogaster dystrophin-l... 33 0.28 AE014297-2675|ABI31179.1| 1051|Drosophila melanogaster CG34157-P... 33 0.28 AE014297-2674|ABI31177.1| 1854|Drosophila melanogaster CG34157-P... 33 0.28 AE014297-2673|AAF55676.3| 1669|Drosophila melanogaster CG34157-P... 33 0.28 AE014297-2671|ABI31178.1| 3504|Drosophila melanogaster CG34157-P... 33 0.28 AE014297-2670|AAF55675.2| 3127|Drosophila melanogaster CG34157-P... 33 0.28 AE014297-2669|AAF55673.2| 3497|Drosophila melanogaster CG34157-P... 33 0.28 AE014297-2668|ABI31176.1| 3598|Drosophila melanogaster CG34157-P... 33 0.28 AE014297-2666|ABI31180.1| 3529|Drosophila melanogaster CG34157-P... 33 0.28 BT011443-1|AAR99101.1| 401|Drosophila melanogaster RE48865p pro... 33 0.37 AF277387-1|AAG17396.2| 614|Drosophila melanogaster dystrobrevin... 33 0.37 AE013599-1497|AAM68687.1| 614|Drosophila melanogaster CG8529-PB... 33 0.37 AE013599-1496|AAF58507.2| 614|Drosophila melanogaster CG8529-PA... 33 0.37 AE013599-1495|AAZ52816.1| 670|Drosophila melanogaster CG8529-PE... 33 0.37 AE013599-1494|AAZ52815.1| 646|Drosophila melanogaster CG8529-PD... 33 0.37 AE013599-1492|AAM68688.2| 623|Drosophila melanogaster CG8529-PC... 33 0.37 U88570-1|AAB53050.1| 3190|Drosophila melanogaster CREB-binding p... 31 1.1 AY070839-1|AAL48461.1| 677|Drosophila melanogaster GH11189p pro... 31 1.1 AE014298-1911|AAF48276.2| 677|Drosophila melanogaster CG32635-P... 31 1.1 AE014298-1361|AAF46516.2| 3276|Drosophila melanogaster CG15319-P... 31 1.1 X99757-1|CAA68088.1| 956|Drosophila melanogaster dystrophin pro... 29 4.5 AY142213-1|AAN52141.1| 555|Drosophila melanogaster transcriptio... 29 4.5 AY058546-1|AAL13775.1| 418|Drosophila melanogaster LD24527p pro... 29 4.5 AF300294-1|AAK15257.1| 1669|Drosophila melanogaster dystrophin-l... 29 4.5 AE014297-707|AAF54199.1| 418|Drosophila melanogaster CG9638-PA,... 29 4.5 AE014297-706|AAZ52519.1| 555|Drosophila melanogaster CG9638-PB,... 29 4.5 U80064-2|AAC24159.1| 649|Drosophila melanogaster discontinuous ... 29 6.0 BT016120-1|AAV37005.1| 649|Drosophila melanogaster LD05408p pro... 29 6.0 AY061613-1|AAL29161.1| 508|Drosophila melanogaster SD08002p pro... 29 6.0 AE014298-2127|AAF48441.1| 649|Drosophila melanogaster CG6157-PA... 29 6.0 AE014297-2614|AAF55624.1| 508|Drosophila melanogaster CG6007-PA... 29 6.0 AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-P... 29 7.9 >X69830-1|CAA49484.1| 590|Drosophila melanogaster ref(2)Pn protein protein. Length = 590 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 136 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 169 >X69829-1|CAA49483.1| 599|Drosophila melanogaster ref(2)Po2 protein protein. Length = 599 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >X69828-1|CAA49482.1| 583|Drosophila melanogaster Ref(2) Pp protein protein. Length = 583 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 136 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 169 >X16993-1|CAA34861.1| 599|Drosophila melanogaster Ref(2)P protein protein. Length = 599 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >U23933-1|AAA98841.1| 591|Drosophila melanogaster Ref(2)P protein protein. Length = 591 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >U23932-1|AAA98840.1| 599|Drosophila melanogaster Ref(2)P protein protein. Length = 599 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >U23931-1|AAA98839.1| 599|Drosophila melanogaster Ref(2)P protein protein. Length = 599 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >U23929-1|AAA98838.1| 599|Drosophila melanogaster Ref(2)P protein protein. Length = 599 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >U23928-1|AAA98837.1| 599|Drosophila melanogaster Ref(2)P protein protein. Length = 599 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >U23927-1|AAA98836.1| 591|Drosophila melanogaster Ref(2)P protein protein. Length = 591 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >U23926-1|AAA98835.1| 591|Drosophila melanogaster Ref(2)P protein protein. Length = 591 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >U23925-1|AAA98834.1| 590|Drosophila melanogaster Ref(2)P protein protein. Length = 590 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 136 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 169 >U23924-1|AAA98833.1| 599|Drosophila melanogaster Ref(2)P protein protein. Length = 599 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >U23923-1|AAA98832.1| 591|Drosophila melanogaster Ref(2)P protein protein. Length = 591 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AY089494-1|AAL90232.1| 599|Drosophila melanogaster GH06306p protein. Length = 599 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114191-1|CAJ35082.2| 436|Drosophila melanogaster Ref(2)P protein protein. Length = 436 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 136 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 169 >AM114190-1|CAJ35081.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114189-1|CAJ35080.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114187-1|CAJ35078.2| 436|Drosophila melanogaster Ref(2)P protein protein. Length = 436 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 136 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 169 >AM114186-1|CAJ35077.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114185-1|CAJ35076.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114183-1|CAJ35074.2| 444|Drosophila melanogaster Ref(2)P protein protein. Length = 444 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 136 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 169 >AM114182-1|CAJ35073.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114181-1|CAJ35072.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114180-1|CAJ35071.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114179-1|CAJ35070.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114178-1|CAJ35069.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114177-1|CAJ35068.2| 436|Drosophila melanogaster Ref(2)P protein protein. Length = 436 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 136 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 169 >AM114176-1|CAJ35067.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114175-1|CAJ35066.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114174-1|CAJ35065.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114173-1|CAJ35064.2| 436|Drosophila melanogaster Ref(2)P protein protein. Length = 436 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 136 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 169 >AM114172-1|CAJ35063.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114171-1|CAJ35062.2| 436|Drosophila melanogaster Ref(2)P protein protein. Length = 436 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 136 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 169 >AM114170-1|CAJ35061.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114169-1|CAJ35060.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114168-1|CAJ35059.2| 436|Drosophila melanogaster Ref(2)P protein protein. Length = 436 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 136 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 169 >AM114167-1|CAJ35058.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114166-1|CAJ35057.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114165-1|CAJ35056.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114163-1|CAJ35054.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114162-1|CAJ35053.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114161-1|CAJ35052.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114160-1|CAJ35051.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114159-1|CAJ35050.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114158-1|CAJ35049.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114157-1|CAJ35048.2| 436|Drosophila melanogaster Ref(2)P protein protein. Length = 436 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 136 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 169 >AM114156-1|CAJ35047.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114155-1|CAJ35046.2| 436|Drosophila melanogaster Ref(2)P protein protein. Length = 436 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 136 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 169 >AM114154-1|CAJ35045.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114153-1|CAJ35044.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114152-1|CAJ35043.2| 436|Drosophila melanogaster Ref(2)P protein protein. Length = 436 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 136 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 169 >AM114151-1|CAJ35042.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114150-1|CAJ35041.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114149-1|CAJ35040.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114148-1|CAJ35039.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114147-1|CAJ35038.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114146-1|CAJ35037.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114145-1|CAJ35036.2| 444|Drosophila melanogaster Ref(2)P protein protein. Length = 444 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 136 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 169 >AM114144-1|CAJ35035.2| 436|Drosophila melanogaster Ref(2)P protein protein. Length = 436 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 136 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 169 >AM114143-1|CAJ35034.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114142-1|CAJ35033.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114141-1|CAJ35032.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114140-1|CAJ35031.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114139-1|CAJ35030.2| 436|Drosophila melanogaster Ref(2)P protein protein. Length = 436 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 136 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 169 >AM114138-1|CAJ35029.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114137-1|CAJ35028.2| 436|Drosophila melanogaster Ref(2)P protein protein. Length = 436 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 136 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 169 >AM114136-1|CAJ35027.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114135-1|CAJ35026.2| 436|Drosophila melanogaster Ref(2)P protein protein. Length = 436 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 136 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 169 >AM114134-1|CAJ35025.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114133-1|CAJ35024.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114132-1|CAJ35023.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114131-1|CAJ35022.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114130-1|CAJ35021.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114129-1|CAJ35020.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114128-1|CAJ35019.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114127-1|CAJ35018.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114126-1|CAJ35017.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114125-1|CAJ35016.2| 436|Drosophila melanogaster Ref(2)P protein protein. Length = 436 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 136 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 169 >AM114124-1|CAJ35015.2| 436|Drosophila melanogaster Ref(2)P protein protein. Length = 436 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 136 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 169 >AM114123-1|CAJ35014.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114122-1|CAJ35013.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114121-1|CAJ35012.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114119-1|CAJ35010.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114118-1|CAJ35009.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114117-1|CAJ35008.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114116-1|CAJ35007.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114115-1|CAJ35006.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114114-1|CAJ35005.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114113-1|CAJ35004.2| 436|Drosophila melanogaster Ref(2)P protein protein. Length = 436 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 136 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 169 >AM114112-1|CAJ35003.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114111-1|CAJ35002.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114110-1|CAJ35001.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114109-1|CAJ35000.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114108-1|CAJ34999.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114107-1|CAJ34998.2| 444|Drosophila melanogaster Ref(2)P protein protein. Length = 444 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 136 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 169 >AM114106-1|CAJ34997.2| 445|Drosophila melanogaster Ref(2)P protein protein. Length = 445 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114105-1|CAJ34996.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AM114104-1|CAJ34995.2| 437|Drosophila melanogaster Ref(2)P protein protein. Length = 437 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AE014134-3129|AAX52671.1| 599|Drosophila melanogaster CG10360-PB, isoform B protein. Length = 599 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AE014134-3128|AAF53824.1| 599|Drosophila melanogaster CG10360-PA, isoform A protein. Length = 599 Score = 54.8 bits (126), Expect = 1e-07 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPT 602 GF YKC C +YDLC KCE A H EH M+R+PT Sbjct: 137 GFRYKCVQCSNYDLCQKCELAHKHPEHLMLRMPT 170 >AY118647-1|AAM50016.1| 1226|Drosophila melanogaster SD05267p protein. Length = 1226 Score = 44.8 bits (101), Expect = 1e-04 Identities = 30/78 (38%), Positives = 38/78 (48%), Gaps = 7/78 (8%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHN-EHCMVRLPTPDMSRTLIKAAIKR---- 644 C Q G +KCA C +YDLCS C H+ H R+ TP RT+++ K Sbjct: 182 CRQQPIFGIRWKCAECINYDLCSICYHGDKHHLRHRFYRITTPGGERTMLEPRRKSKKVL 241 Query: 645 SRHIFQN-RVATHVD-QW 692 +R IF RV VD QW Sbjct: 242 ARGIFPGARVVRGVDWQW 259 >AE014296-2615|AAF49551.3| 1226|Drosophila melanogaster CG5841-PA protein. Length = 1226 Score = 44.8 bits (101), Expect = 1e-04 Identities = 30/78 (38%), Positives = 38/78 (48%), Gaps = 7/78 (8%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHN-EHCMVRLPTPDMSRTLIKAAIKR---- 644 C Q G +KCA C +YDLCS C H+ H R+ TP RT+++ K Sbjct: 182 CRQQPIFGIRWKCAECINYDLCSICYHGDKHHLRHRFYRITTPGGERTMLEPRRKSKKVL 241 Query: 645 SRHIFQN-RVATHVD-QW 692 +R IF RV VD QW Sbjct: 242 ARGIFPGARVVRGVDWQW 259 >AM114188-2|CAJ38358.1| 300|Drosophila melanogaster Ref(2)P protein protein. Length = 300 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +3 Query: 531 DYDLCSKCEAAGNHNEHCMVRLPT 602 +YDLC KCE A H EH M+R+PT Sbjct: 2 NYDLCQKCELAHKHPEHLMLRMPT 25 >AM114184-2|CAJ38354.1| 292|Drosophila melanogaster Ref(2)P protein protein. Length = 292 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +3 Query: 531 DYDLCSKCEAAGNHNEHCMVRLPT 602 +YDLC KCE A H EH M+R+PT Sbjct: 2 NYDLCQKCELAHKHPEHLMLRMPT 25 >AM114164-2|CAJ38334.1| 300|Drosophila melanogaster Ref(2)P protein protein. Length = 300 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +3 Query: 531 DYDLCSKCEAAGNHNEHCMVRLPT 602 +YDLC KCE A H EH M+R+PT Sbjct: 2 NYDLCQKCELAHKHPEHLMLRMPT 25 >AM114120-2|CAJ38290.1| 292|Drosophila melanogaster Ref(2)P protein protein. Length = 292 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +3 Query: 531 DYDLCSKCEAAGNHNEHCMVRLPT 602 +YDLC KCE A H EH M+R+PT Sbjct: 2 NYDLCQKCELAHKHPEHLMLRMPT 25 >BT016111-1|AAV36996.1| 1049|Drosophila melanogaster LD11955p protein. Length = 1049 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHN-EHCMVRLPTPD 608 C + G +KCA C +Y LC+ C A H+ EH +R TP+ Sbjct: 90 CSKAGIAGIVFKCAQCPNYHLCAYCYAEDLHDIEHPFIRYTTPN 133 >AE014134-3020|AAF53743.1| 1049|Drosophila melanogaster CG17492-PA protein. Length = 1049 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHN-EHCMVRLPTPD 608 C + G +KCA C +Y LC+ C A H+ EH +R TP+ Sbjct: 90 CSKAGIAGIVFKCAQCPNYHLCAYCYAEDLHDIEHPFIRYTTPN 133 >BT024222-1|ABC86284.1| 599|Drosophila melanogaster LP17815p protein. Length = 599 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLP 599 C++ + G YKC IC+DYDLC+ C G + +V P Sbjct: 12 CLKSNFNGRRYKCLICYDYDLCADCYEDGVTSTRHLVEHP 51 >BT001502-1|AAN71257.1| 599|Drosophila melanogaster LD34776p protein. Length = 599 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLP 599 C++ + G YKC IC+DYDLC+ C G + +V P Sbjct: 12 CLKSNFNGRRYKCLICYDYDLCADCYEDGVTSTRHLVEHP 51 >BT001483-1|AAN71238.1| 599|Drosophila melanogaster LD22379p protein. Length = 599 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLP 599 C++ + G YKC IC+DYDLC+ C G + +V P Sbjct: 12 CLKSNFNGRRYKCLICYDYDLCADCYEDGVTSTRHLVEHP 51 >AY061066-1|AAL28614.1| 599|Drosophila melanogaster LD03515p protein. Length = 599 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLP 599 C++ + G YKC IC+DYDLC+ C G + +V P Sbjct: 12 CLKSNFNGRRYKCLICYDYDLCADCYEDGVTSTRHLVEHP 51 >AE014297-858|AAF54325.2| 643|Drosophila melanogaster CG11984-PC, isoform C protein. Length = 643 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLP 599 C++ + G YKC IC+DYDLC+ C G + +V P Sbjct: 12 CLKSNFNGRRYKCLICYDYDLCADCYEDGVTSTRHLVEHP 51 >AE014297-857|AAF54323.2| 643|Drosophila melanogaster CG11984-PB, isoform B protein. Length = 643 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLP 599 C++ + G YKC IC+DYDLC+ C G + +V P Sbjct: 12 CLKSNFNGRRYKCLICYDYDLCADCYEDGVTSTRHLVEHP 51 >AE014297-856|AAF54324.2| 643|Drosophila melanogaster CG11984-PA, isoform A protein. Length = 643 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLP 599 C++ + G YKC IC+DYDLC+ C G + +V P Sbjct: 12 CLKSNFNGRRYKCLICYDYDLCADCYEDGVTSTRHLVEHP 51 >BT023118-1|AAY55534.1| 221|Drosophila melanogaster IP08740p protein. Length = 221 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +3 Query: 504 FPYKCAICHDYDLCSKCEAAGNHN 575 + YKC C DYDLCS C+ G N Sbjct: 35 YRYKCLHCLDYDLCSDCKENGVSN 58 >AL138971-5|CAB72283.1| 295|Drosophila melanogaster EG:BACR43E12.4 protein. Length = 295 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +3 Query: 504 FPYKCAICHDYDLCSKCEAAGNHN 575 + YKC C DYDLCS C+ G N Sbjct: 109 YRYKCLHCLDYDLCSDCKENGVSN 132 >AE014298-474|AAF45832.1| 215|Drosophila melanogaster CG3526-PA, isoform A protein. Length = 215 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +3 Query: 504 FPYKCAICHDYDLCSKCEAAGNHN 575 + YKC C DYDLCS C+ G N Sbjct: 29 YRYKCLHCLDYDLCSDCKENGVSN 52 >AE014298-473|AAN09090.1| 294|Drosophila melanogaster CG3526-PB, isoform B protein. Length = 294 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +3 Query: 504 FPYKCAICHDYDLCSKCEAAGNHN 575 + YKC C DYDLCS C+ G N Sbjct: 108 YRYKCLHCLDYDLCSDCKENGVSN 131 >AE013599-2072|AAM70976.1| 733|Drosophila melanogaster CG30471-PA protein. Length = 733 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = -3 Query: 396 VIISNIWILAVNVELNQPTLQRH*CSHHFI 307 V+I +IWIL VN +N+ TL+RH + F+ Sbjct: 8 VLIISIWILVVNAAVNESTLRRHRYEYGFL 37 >BT010020-1|AAQ22489.1| 1051|Drosophila melanogaster RE11449p protein. Length = 1051 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPTPDMSRT 620 C + GF Y+C C ++D+C KC G + ++ + P + T Sbjct: 669 CKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTT 715 >AY875639-1|AAX59985.1| 1854|Drosophila melanogaster Dp205 protein. Length = 1854 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPTPDMSRT 620 C + GF Y+C C ++D+C KC G + ++ + P + T Sbjct: 1472 CKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTT 1518 >AY128502-1|AAM75095.1| 706|Drosophila melanogaster SD03660p protein. Length = 706 Score = 33.5 bits (73), Expect = 0.28 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +3 Query: 537 DLCSKCEAAGNHNEHCMVRLPTPDMSRTLIKAAIKRSRHIFQNRVATHV-DQW 692 +LC + + + VR PT D RT I + K +H F+N+VA H +QW Sbjct: 274 NLCYALQLMYYYIKLIFVREPTADFKRTYIDLSSK-FQHFFENKVALHAKEQW 325 >AF297644-1|AAK15256.1| 3497|Drosophila melanogaster dystrophin-like protein DLP2 protein. Length = 3497 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPTPDMSRT 620 C + GF Y+C C ++D+C KC G + ++ + P + T Sbjct: 3115 CKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTT 3161 >AF277386-1|AAG17395.1| 3127|Drosophila melanogaster dystrophin-like protein DYS protein. Length = 3127 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPTPDMSRT 620 C + GF Y+C C ++D+C KC G + ++ + P + T Sbjct: 2745 CKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTT 2791 >AE014297-2675|ABI31179.1| 1051|Drosophila melanogaster CG34157-PE, isoform E protein. Length = 1051 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPTPDMSRT 620 C + GF Y+C C ++D+C KC G + ++ + P + T Sbjct: 669 CKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTT 715 >AE014297-2674|ABI31177.1| 1854|Drosophila melanogaster CG34157-PD, isoform D protein. Length = 1854 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPTPDMSRT 620 C + GF Y+C C ++D+C KC G + ++ + P + T Sbjct: 1472 CKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTT 1518 >AE014297-2673|AAF55676.3| 1669|Drosophila melanogaster CG34157-PB, isoform B protein. Length = 1669 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPTPDMSRT 620 C + GF Y+C C ++D+C KC G + ++ + P + T Sbjct: 1287 CKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTT 1333 >AE014297-2671|ABI31178.1| 3504|Drosophila melanogaster CG34157-PG, isoform G protein. Length = 3504 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPTPDMSRT 620 C + GF Y+C C ++D+C KC G + ++ + P + T Sbjct: 3122 CKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTT 3168 >AE014297-2670|AAF55675.2| 3127|Drosophila melanogaster CG34157-PC, isoform C protein. Length = 3127 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPTPDMSRT 620 C + GF Y+C C ++D+C KC G + ++ + P + T Sbjct: 2745 CKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTT 2791 >AE014297-2669|AAF55673.2| 3497|Drosophila melanogaster CG34157-PA, isoform A protein. Length = 3497 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPTPDMSRT 620 C + GF Y+C C ++D+C KC G + ++ + P + T Sbjct: 3115 CKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTT 3161 >AE014297-2668|ABI31176.1| 3598|Drosophila melanogaster CG34157-PH, isoform H protein. Length = 3598 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPTPDMSRT 620 C + GF Y+C C ++D+C KC G + ++ + P + T Sbjct: 3115 CKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTT 3161 >AE014297-2666|ABI31180.1| 3529|Drosophila melanogaster CG34157-PF, isoform F protein. Length = 3529 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPTPDMSRT 620 C + GF Y+C C ++D+C KC G + ++ + P + T Sbjct: 3147 CKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTT 3193 >BT011443-1|AAR99101.1| 401|Drosophila melanogaster RE48865p protein. Length = 401 Score = 33.1 bits (72), Expect = 0.37 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKC 554 C + + GF Y+C CH Y LC +C Sbjct: 237 CHKENFTGFRYRCQRCHAYQLCQEC 261 >AF277387-1|AAG17396.2| 614|Drosophila melanogaster dystrobrevin-like protein DYB protein. Length = 614 Score = 33.1 bits (72), Expect = 0.37 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKC 554 C + + GF Y+C CH Y LC +C Sbjct: 237 CHKENFTGFRYRCQRCHAYQLCQEC 261 >AE013599-1497|AAM68687.1| 614|Drosophila melanogaster CG8529-PB, isoform B protein. Length = 614 Score = 33.1 bits (72), Expect = 0.37 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKC 554 C + + GF Y+C CH Y LC +C Sbjct: 237 CHKENFTGFRYRCQRCHAYQLCQEC 261 >AE013599-1496|AAF58507.2| 614|Drosophila melanogaster CG8529-PA, isoform A protein. Length = 614 Score = 33.1 bits (72), Expect = 0.37 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKC 554 C + + GF Y+C CH Y LC +C Sbjct: 237 CHKENFTGFRYRCQRCHAYQLCQEC 261 >AE013599-1495|AAZ52816.1| 670|Drosophila melanogaster CG8529-PE, isoform E protein. Length = 670 Score = 33.1 bits (72), Expect = 0.37 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKC 554 C + + GF Y+C CH Y LC +C Sbjct: 237 CHKENFTGFRYRCQRCHAYQLCQEC 261 >AE013599-1494|AAZ52815.1| 646|Drosophila melanogaster CG8529-PD, isoform D protein. Length = 646 Score = 33.1 bits (72), Expect = 0.37 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKC 554 C + + GF Y+C CH Y LC +C Sbjct: 237 CHKENFTGFRYRCQRCHAYQLCQEC 261 >AE013599-1492|AAM68688.2| 623|Drosophila melanogaster CG8529-PC, isoform C protein. Length = 623 Score = 33.1 bits (72), Expect = 0.37 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKC 554 C + + GF Y+C CH Y LC +C Sbjct: 246 CHKENFTGFRYRCQRCHAYQLCQEC 270 >U88570-1|AAB53050.1| 3190|Drosophila melanogaster CREB-binding protein homolog protein. Length = 3190 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 510 YKCAICHDYDLCSKCEAAGNHNEHCMVRL 596 Y C +C D+DLC C+ H +H M +L Sbjct: 2346 YHCTVCDDFDLCIVCKEKVGH-QHKMEKL 2373 >AY070839-1|AAL48461.1| 677|Drosophila melanogaster GH11189p protein. Length = 677 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 4/44 (9%) Frame = -1 Query: 638 NCRL---DQGARHVRCGETDHAVFIVIPGGLALGAQVVV-MTNC 519 NC+ ++G G+++H V IVI GL LG V+ + NC Sbjct: 416 NCKFRWDEEGCTSEAAGQSEHVVIIVIVFGLILGGMVITFIVNC 459 >AE014298-1911|AAF48276.2| 677|Drosophila melanogaster CG32635-PA protein. Length = 677 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 4/44 (9%) Frame = -1 Query: 638 NCRL---DQGARHVRCGETDHAVFIVIPGGLALGAQVVV-MTNC 519 NC+ ++G G+++H V IVI GL LG V+ + NC Sbjct: 416 NCKFRWDEEGCTSEAAGQSEHVVIIVIVFGLILGGMVITFIVNC 459 >AE014298-1361|AAF46516.2| 3276|Drosophila melanogaster CG15319-PB protein. Length = 3276 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 510 YKCAICHDYDLCSKCEAAGNHNEHCMVRL 596 Y C +C D+DLC C+ H +H M +L Sbjct: 2346 YHCTVCDDFDLCIVCKEKVGH-QHKMEKL 2373 >X99757-1|CAA68088.1| 956|Drosophila melanogaster dystrophin protein. Length = 956 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/47 (25%), Positives = 22/47 (46%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPTPDMSRT 620 C + F Y+C C ++D+C KC G + ++ + P + T Sbjct: 645 CKEYPIVLFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTT 691 >AY142213-1|AAN52141.1| 555|Drosophila melanogaster transcriptional adapter 2S protein. Length = 555 Score = 29.5 bits (63), Expect = 4.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAG 566 G CA C ++DLC +C AAG Sbjct: 22 GIRVHCAECENFDLCLQCFAAG 43 >AY058546-1|AAL13775.1| 418|Drosophila melanogaster LD24527p protein. Length = 418 Score = 29.5 bits (63), Expect = 4.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAG 566 G CA C ++DLC +C AAG Sbjct: 22 GIRVHCAECENFDLCLQCFAAG 43 >AF300294-1|AAK15257.1| 1669|Drosophila melanogaster dystrophin-like protein DLP186 protein. Length = 1669 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/47 (25%), Positives = 22/47 (46%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAGNHNEHCMVRLPTPDMSRT 620 C + F Y+C C ++D+C KC G + ++ + P + T Sbjct: 1287 CKEYPIVLFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTT 1333 >AE014297-707|AAF54199.1| 418|Drosophila melanogaster CG9638-PA, isoform A protein. Length = 418 Score = 29.5 bits (63), Expect = 4.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAG 566 G CA C ++DLC +C AAG Sbjct: 22 GIRVHCAECENFDLCLQCFAAG 43 >AE014297-706|AAZ52519.1| 555|Drosophila melanogaster CG9638-PB, isoform B protein. Length = 555 Score = 29.5 bits (63), Expect = 4.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 501 GFPYKCAICHDYDLCSKCEAAG 566 G CA C ++DLC +C AAG Sbjct: 22 GIRVHCAECENFDLCLQCFAAG 43 >U80064-2|AAC24159.1| 649|Drosophila melanogaster discontinuous actin hexagon protein. Length = 649 Score = 29.1 bits (62), Expect = 6.0 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAG 566 C + G ++C +C D LC C A G Sbjct: 286 CRKEHIVGIRFRCQVCRDISLCLPCFAVG 314 >BT016120-1|AAV37005.1| 649|Drosophila melanogaster LD05408p protein. Length = 649 Score = 29.1 bits (62), Expect = 6.0 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAG 566 C + G ++C +C D LC C A G Sbjct: 286 CRKEHIVGIRFRCQVCRDISLCLPCFAVG 314 >AY061613-1|AAL29161.1| 508|Drosophila melanogaster SD08002p protein. Length = 508 Score = 29.1 bits (62), Expect = 6.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 111 TWSSIFDLYKCTGRKMTQITRINTGVT 31 TWS + DL +C+G + Q++ NT + Sbjct: 287 TWSKVADLLECSGASVRQVSLPNTAAS 313 >AE014298-2127|AAF48441.1| 649|Drosophila melanogaster CG6157-PA protein. Length = 649 Score = 29.1 bits (62), Expect = 6.0 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 480 CMQLSSCGFPYKCAICHDYDLCSKCEAAG 566 C + G ++C +C D LC C A G Sbjct: 286 CRKEHIVGIRFRCQVCRDISLCLPCFAVG 314 >AE014297-2614|AAF55624.1| 508|Drosophila melanogaster CG6007-PA protein. Length = 508 Score = 29.1 bits (62), Expect = 6.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 111 TWSSIFDLYKCTGRKMTQITRINTGVT 31 TWS + DL +C+G + Q++ NT + Sbjct: 287 TWSKVADLLECSGASVRQVSLPNTAAS 313 >AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-PB protein. Length = 23015 Score = 28.7 bits (61), Expect = 7.9 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 4/47 (8%) Frame = +3 Query: 477 QCMQ--LSSCGFPYKCAICHDYDLCSKCEA--AGNHNEHCMVRLPTP 605 +CM + +CGF KC + + +CS C A GN E CM + P Sbjct: 9792 KCMDPCVGTCGFNAKCQVNNHNPICS-CPANYEGNPFEQCMPKPAEP 9837 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,607,881 Number of Sequences: 53049 Number of extensions: 674959 Number of successful extensions: 2259 Number of sequences better than 10.0: 157 Number of HSP's better than 10.0 without gapping: 2055 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2257 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3026039247 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -