SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesV0515.Seq
         (449 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBP19A11.02c |||sequence orphan|Schizosaccharomyces pombe|chr 2...    27   1.0  
SPCC550.02c |cwf5|ecm2|RNA-binding protein Cwf5|Schizosaccharomy...    24   9.4  

>SPBP19A11.02c |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 244

 Score = 27.5 bits (58), Expect = 1.0
 Identities = 14/47 (29%), Positives = 24/47 (51%)
 Frame = +1

Query: 208 STLATTTIQFLVKVVTINTTTSGPKRISITNR*MRG*PSTHYSTTTS 348
           ST   +T   +    ++NTTT+ P   S+        P+TH ++TT+
Sbjct: 74  STSHNSTTTTVPPTTSMNTTTTVPPTTSLNTTTTTAPPTTHVNSTTT 120


>SPCC550.02c |cwf5|ecm2|RNA-binding protein Cwf5|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 354

 Score = 24.2 bits (50), Expect = 9.4
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +2

Query: 284 EFPSLTDRCAGD 319
           EFPS+ +RC GD
Sbjct: 18  EFPSICERCLGD 29


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,652,043
Number of Sequences: 5004
Number of extensions: 26925
Number of successful extensions: 64
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 63
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 64
length of database: 2,362,478
effective HSP length: 67
effective length of database: 2,027,210
effective search space used: 166231220
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -