BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0510.Seq (299 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0871 + 23865343-23866016,23866122-23866170,23866276-238663... 29 0.67 01_01_0635 - 4795434-4795461,4795897-4797365 28 1.2 04_01_0422 + 5573833-5574647,5575577-5575692,5576922-5577130,557... 27 2.7 02_05_0887 + 32516255-32517292 27 2.7 08_02_1146 + 24678142-24678258,24678550-24678587,24678997-246790... 27 3.6 03_05_0836 - 28088832-28089422,28089626-28089831,28089985-28090330 27 3.6 08_02_1336 - 26233081-26233312,26233814-26234672,26235218-26236736 26 4.7 01_06_0922 - 33022709-33023545 26 4.7 06_03_0215 - 18080286-18080914,18080925-18080997 26 6.3 02_01_0549 - 4038699-4038753,4039225-4039514,4039673-4039970,404... 26 6.3 01_07_0173 + 41708463-41708709,41709285-41709606,41710389-41710638 26 6.3 09_02_0492 - 9866492-9866848 25 8.3 08_02_1442 + 27120604-27120890,27121029-27121166,27121280-271213... 25 8.3 05_07_0257 + 28719980-28720220,28721412-28721455,28722521-287225... 25 8.3 03_02_0149 + 5933134-5933207,5935039-5935267,5935370-5935468,593... 25 8.3 >12_02_0871 + 23865343-23866016,23866122-23866170,23866276-23866356, 23866599-23866718,23866957-23867055,23867135-23867194, 23867316-23867410,23867483-23867508,23869212-23869285, 23870194-23870259,23871027-23871099,23871585-23871622, 23873758-23873871,23876079-23876195,23876288-23876368, 23876468-23876536,23876631-23876669,23876809-23876973, 23877380-23877484,23877569-23877637,23877754-23877816, 23877903-23878021,23878124-23878348,23878409-23878610 Length = 940 Score = 29.1 bits (62), Expect = 0.67 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = +3 Query: 3 ELDERALDALKEFPSDGALSVLGQFLDSNLEHVSNKSAFLCGVMKTYRQKS 155 ++D + +L E P A++VL QFL S + NK + ++ Y+ ++ Sbjct: 715 DIDIHCIRSLNELPEKAAVAVLNQFLISGADK-HNKGDYFASLIAKYQAET 764 >01_01_0635 - 4795434-4795461,4795897-4797365 Length = 498 Score = 28.3 bits (60), Expect = 1.2 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -2 Query: 121 KKALLLDTCSRFESKNCPRTLKAPSDGNSFKASRARS 11 KK +LLD C+ + +K P T + S+G SF +S S Sbjct: 446 KKKVLLD-CTGYSNKGSPSTARRMSEGLSFISSEMPS 481 >04_01_0422 + 5573833-5574647,5575577-5575692,5576922-5577130, 5579676-5579795,5581616-5581744,5581828-5581953, 5582945-5583000,5583084-5583183,5585155-5585272, 5585374-5585583,5585902-5586226,5587094-5587187, 5588021-5588129,5588246-5588514,5589153-5589280, 5589983-5590217,5590858-5591046,5591326-5591609, 5591698-5591890,5592040-5592207,5592429-5592514, 5594391-5594550 Length = 1412 Score = 27.1 bits (57), Expect = 2.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 106 LDTCSRFESKNCPRTLKAPSD 44 LD SR ESK CP L P D Sbjct: 524 LDALSRCESKTCPSELITPPD 544 >02_05_0887 + 32516255-32517292 Length = 345 Score = 27.1 bits (57), Expect = 2.7 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +2 Query: 5 VGRACSRCLKRISIRRCFKCSWTIFRFKSRTCIQ*KCFFVWSYEDL 142 V AC C ++ + + + K RTC+Q C FV +Y++L Sbjct: 128 VDLACPLCRGKVKGWTIVEPARSYLNGKRRTCMQDGCSFVGTYKEL 173 >08_02_1146 + 24678142-24678258,24678550-24678587,24678997-24679012, 24679874-24680002,24680073-24680229,24680337-24680530, 24680668-24680916,24681196-24681309,24681949-24681990, 24682402-24682572,24682932-24683104,24683378-24683624, 24684046-24684130,24684401-24684510,24684714-24684977, 24685885-24685950,24686431-24686525,24686780-24686858 Length = 781 Score = 26.6 bits (56), Expect = 3.6 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +3 Query: 120 LCGVMKTYRQKSRAGVPGAPALTPTVQVKGPDEEKIK 230 L GV++++ +AGVP P P + + D++ I+ Sbjct: 159 LSGVLRSFLASGQAGVPFQPVPVPALGLSESDKQCIR 195 >03_05_0836 - 28088832-28089422,28089626-28089831,28089985-28090330 Length = 380 Score = 26.6 bits (56), Expect = 3.6 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 221 EDKANLGPNRLPLDVTTGQRKYPSP 295 ++ A +GP R PLD T Q SP Sbjct: 113 DEDATIGPERRPLDALTEQELVESP 137 >08_02_1336 - 26233081-26233312,26233814-26234672,26235218-26236736 Length = 869 Score = 26.2 bits (55), Expect = 4.7 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 66 LGQFLDSNLEHVSNKSAFLCGVMKTYRQKSRAG 164 +GQF+D + E N S L GV++ +R+G Sbjct: 786 VGQFMDPSSEDKDNSSYHLVGVIEHIGPSTRSG 818 >01_06_0922 - 33022709-33023545 Length = 278 Score = 26.2 bits (55), Expect = 4.7 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 153 SRAGVPGAPALTPTVQVKGPDEEKIKQILART 248 SR P A A P P+EEK+K++L+ T Sbjct: 20 SRRCKPPAEARDPPPPPPLPEEEKVKEVLSET 51 >06_03_0215 - 18080286-18080914,18080925-18080997 Length = 233 Score = 25.8 bits (54), Expect = 6.3 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -2 Query: 136 FITPHKKALLLDTCSRFESKNCPRTLKAPS 47 F+ P++ A L + RF CP + PS Sbjct: 99 FVVPNRAAAFLRSGRRFRRPRCPGVSRGPS 128 >02_01_0549 - 4038699-4038753,4039225-4039514,4039673-4039970, 4040779-4040849,4040966-4041079,4041166-4041240, 4041347-4041405,4041870-4041912 Length = 334 Score = 25.8 bits (54), Expect = 6.3 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -2 Query: 82 SKNCPRTLKAPSD 44 SKNC RTLK P D Sbjct: 89 SKNCRRTLKVPKD 101 >01_07_0173 + 41708463-41708709,41709285-41709606,41710389-41710638 Length = 272 Score = 25.8 bits (54), Expect = 6.3 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 115 ALLLDTCSRFESKNCPRTLKAPSDGNSF 32 A+LL+ R E +C L AP+DG F Sbjct: 25 AVLLNPADREEWHDCLPDLSAPADGEDF 52 >09_02_0492 - 9866492-9866848 Length = 118 Score = 25.4 bits (53), Expect = 8.3 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 70 DNF*IQISNMYPIKVLFCVEL*RPIDRKVGRAF 168 DNF + ++ +P V FCV L I + R F Sbjct: 34 DNFSVSLAPPHPSHVSFCVALFGAIASSIARRF 66 >08_02_1442 + 27120604-27120890,27121029-27121166,27121280-27121382, 27121877-27122036,27122927-27123114,27123203-27124770, 27124882-27125869,27126595-27127098,27127347-27127433, 27127753-27127821,27128012-27128041 Length = 1373 Score = 25.4 bits (53), Expect = 8.3 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 Query: 23 RCLKRISIRRCFKC 64 RCLKR+ I RC +C Sbjct: 992 RCLKRLIIERCPRC 1005 >05_07_0257 + 28719980-28720220,28721412-28721455,28722521-28722590, 28722693-28722816,28723420-28724060,28725100-28725364, 28725434-28725713,28726042-28726209,28726867-28727358, 28727432-28727689 Length = 860 Score = 25.4 bits (53), Expect = 8.3 Identities = 8/30 (26%), Positives = 17/30 (56%) Frame = +3 Query: 162 GVPGAPALTPTVQVKGPDEEKIKQILARTG 251 G+PG P++ V++ P + ++ + TG Sbjct: 194 GMPGRPSMADIVKMGKPQAKPVRSVACNTG 223 >03_02_0149 + 5933134-5933207,5935039-5935267,5935370-5935468, 5935582-5935616,5935694-5935769,5936552-5936662, 5937001-5937087,5937302-5937395,5937489-5937606, 5938047-5938542,5939263-5939298,5940047-5940578, 5940668-5940792 Length = 703 Score = 25.4 bits (53), Expect = 8.3 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +3 Query: 162 GVPGAPALTPTVQVKGPDEEKIKQILARTGYR*M*LQVNASTQVRC 299 G P+L V+GP+++ I I+ TG + + T V C Sbjct: 220 GFHADPSLNVAAWVRGPNDQYINHIMNETGVTVVLRGKGSGTPVNC 265 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,567,151 Number of Sequences: 37544 Number of extensions: 159967 Number of successful extensions: 432 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 432 length of database: 14,793,348 effective HSP length: 71 effective length of database: 12,127,724 effective search space used: 339576272 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -