BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0500.Seq (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBPB2B2.06c |||phosphoprotein phosphatase |Schizosaccharomyces ... 26 4.5 SPBC651.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 26 4.5 SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pomb... 26 4.5 SPAC26H5.04 |||vacuolar import and degradation protein Vid28|Sch... 25 7.9 >SPBPB2B2.06c |||phosphoprotein phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 601 Score = 26.2 bits (55), Expect = 4.5 Identities = 21/74 (28%), Positives = 30/74 (40%) Frame = -1 Query: 590 FIPGLSGLLSASRYYIKHPHDM*FTDQFPLVLGTYTYIRTVHKIAVVFYLQP*GIRNSTN 411 F+P +G AS I + + +QF +T V +AV F G N+T Sbjct: 151 FVPHWNGTYLASNVQIFNSSNE--LEQFAAESAYFTTKHGVRVLAVGFLYDFTGNANNTV 208 Query: 410 IY*VSKKCNEHWYQ 369 + V N WYQ Sbjct: 209 VTPVETAVNSRWYQ 222 >SPBC651.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 237 Score = 26.2 bits (55), Expect = 4.5 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +1 Query: 583 GIKLHFPNAGSSISWATLPLTXNNARFVTPTGSTDSI 693 G+ +H+ ++GS S TLPL F+ T+ + Sbjct: 171 GLGIHYNHSGSQSSLITLPLPQKQPDFLRMNNDTNEL 207 >SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pombe|chr 2|||Manual Length = 2386 Score = 26.2 bits (55), Expect = 4.5 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -1 Query: 245 IILRRRLKNISPPGMFKN 192 I+LRRRL ++P G FK+ Sbjct: 1622 IVLRRRLSQVAPYGKFKH 1639 >SPAC26H5.04 |||vacuolar import and degradation protein Vid28|Schizosaccharomyces pombe|chr 1|||Manual Length = 729 Score = 25.4 bits (53), Expect = 7.9 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -2 Query: 205 ECLRILRMSIAQIHRIIS*LSSCPGSPRRIAIPRQVPSRTTQ 80 + LRI +S +HR+I S SPR + Q+ +R TQ Sbjct: 162 DVLRISNLSSKILHRLILYNSKVGDSPRFCSALFQITNRATQ 203 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,860,658 Number of Sequences: 5004 Number of extensions: 61200 Number of successful extensions: 115 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -