BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0493.Seq (695 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 24 4.0 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 24 5.3 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 24.2 bits (50), Expect = 4.0 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = -3 Query: 450 GNGNEEFILRRRQVFYLFKSGYHDIGLDRYYHHFRPLHHGYIFK 319 GNG +FI R+R + + YH R++ +F L Y+ + Sbjct: 51 GNG-ADFITRKRLLTDVLSDMYHRFASHRFFGYFDFLSPIYVVR 93 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.8 bits (49), Expect = 5.3 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -3 Query: 261 TATVISSGFA-RPAEIKPFAKANASLPPPINPI 166 TAT ++ A R AE+ PF N + PP++PI Sbjct: 1124 TATSPAAEVAPRIAEVAPFPATN-GMAPPLSPI 1155 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 684,147 Number of Sequences: 2352 Number of extensions: 13840 Number of successful extensions: 26 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -