BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0491.Seq (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 23 2.8 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 2.8 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 3.7 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 3.7 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 4.9 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 8.5 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 23.0 bits (47), Expect = 2.8 Identities = 15/47 (31%), Positives = 19/47 (40%) Frame = +2 Query: 557 GDCS*SRHSQTQLCLGERPA*FLKPTIHHKVVVFMGSPADPRTFVRK 697 G C LC+ R +L P + MGSP TFVR+ Sbjct: 181 GSCKCIYVQSINLCMAGRLFGYLCPGMALSQFDLMGSPYRNLTFVRR 227 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.0 bits (47), Expect = 2.8 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 224 PKQETFFKDDETTIPNGQRSKSFQPNS 304 PK+ET KDD+ + +S+ PNS Sbjct: 81 PKEETDDKDDDESDNENIKSQKEFPNS 107 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 215 FTPPKQETFFKDDETTIPNG 274 FT K T+F+ +TTI NG Sbjct: 454 FTVDKLITYFEQFDTTINNG 473 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 215 FTPPKQETFFKDDETTIPNG 274 FT K T+F+ +TTI NG Sbjct: 454 FTVDKLITYFEQFDTTINNG 473 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -1 Query: 509 TEGHNLQESESMTSANTMLPSVSTP 435 + GH+ + E M +M P + TP Sbjct: 705 SHGHDSGQDEDMAEDLSMAPDIMTP 729 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/44 (22%), Positives = 16/44 (36%) Frame = +2 Query: 179 LKRNPGVPEGFRFTPPKQETFFKDDETTIPNGQRSKSFQPNSII 310 L N + F+ PP + D+E + PNS + Sbjct: 545 LNYNENIERFFKSKPPVATMYGSDEEIINSSNDEGGKTSPNSAV 588 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,938 Number of Sequences: 438 Number of extensions: 4551 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -