BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0490.Seq (748 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 24 1.1 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 23 3.4 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 22 4.5 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 7.9 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 145 MGYPPPCNWLFPKKK 189 +G PP WLF KKK Sbjct: 318 LGSLPPFKWLFKKKK 332 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +3 Query: 630 PRFHHKVVXFNGFTSRPRNIVRK*PK 707 P FH + FNG P+NI+++ P+ Sbjct: 33 PDFHESTM-FNGGGEIPQNIIQQQPQ 57 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +1 Query: 154 PPPCNWLFPKKKSWCTRRLQVH 219 P CNWLF K+ + LQ H Sbjct: 344 PFVCNWLFCGKRFTRSDELQRH 365 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 7.9 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -1 Query: 553 CEFRYTCLSTINLLSRKPQSPRSQNR*HPPIQCYLLYRLRILFS 422 C ++ LSTIN R + Q +PP + Y R +FS Sbjct: 524 CGMKWPLLSTINRHLRGNELLPMQQSQNPPTKPYGTCRSEGIFS 567 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,137 Number of Sequences: 336 Number of extensions: 3951 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -