BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0489.Seq (692 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 24 1.2 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 23 2.1 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 23 2.1 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 23 2.1 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 22 4.8 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 22 4.8 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 6.4 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 6.4 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 6.4 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 24.2 bits (50), Expect = 1.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 281 PPPVSVKTTGPVWDIGQVL 337 PP V ++ TG W++G +L Sbjct: 92 PPAVLLQLTGGTWELGPML 110 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 2.1 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +1 Query: 592 QERGNNQPIWKAAGTT 639 +E G+N P+W+AA + Sbjct: 25 EETGSNLPVWEAAAAS 40 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 2.1 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +1 Query: 592 QERGNNQPIWKAAGTT 639 +E G+N P+W+AA + Sbjct: 25 EETGSNLPVWEAAAAS 40 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 2.1 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +1 Query: 592 QERGNNQPIWKAAGTT 639 +E G+N P+W+AA + Sbjct: 25 EETGSNLPVWEAAAAS 40 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = +1 Query: 310 PSLGHRTGLKSGSSS 354 PS+ +R+GL SGSS+ Sbjct: 381 PSIRNRSGLVSGSST 395 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 528 PNLCDGFPCTVG*VSQETPI 469 P + DG P T+G V++E I Sbjct: 78 PRIQDGVPLTLGYVTREVSI 97 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 6.4 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = -2 Query: 316 NWAGSFNGNRW 284 NW G F G+ W Sbjct: 163 NWVGVFGGSAW 173 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -1 Query: 671 GTTVLPFPLKWVVPAAFQIGWLLPRSWLLPWV 576 G VLPF W V F++ W+ W W+ Sbjct: 115 GLAVLPFSATWEV---FKV-WIFGDLWCSIWL 142 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 6.4 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = -2 Query: 316 NWAGSFNGNRW 284 NW G F G+ W Sbjct: 163 NWVGVFGGSAW 173 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,526 Number of Sequences: 438 Number of extensions: 4664 Number of successful extensions: 19 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -