BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0487.Seq (697 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 25 3.0 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 24 4.0 AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 24 5.3 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 24 5.3 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 24.6 bits (51), Expect = 3.0 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 291 RCLHAVGSGGTPGWPCDPKNTI 356 +CLH + +G + GW +NT+ Sbjct: 16 KCLHPLRTGRSQGWYMHGRNTL 37 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 24.2 bits (50), Expect = 4.0 Identities = 12/30 (40%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = -2 Query: 681 WPGIRRPCRTSSRLCRPP-RNLLCT-RGNC 598 W G CR S+ C PP LC+ G C Sbjct: 622 WTGPACDCRASNETCMPPGGGELCSGHGTC 651 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 23.8 bits (49), Expect = 5.3 Identities = 9/38 (23%), Positives = 20/38 (52%) Frame = +3 Query: 471 PRRMAGRTYAYPSHNQPSR*EALHRCRFSFSLRENEPC 584 P + R + +P N + + L C +++ L+++E C Sbjct: 84 PHVICCRLWRWPDLNSHTELKPLDVCEYAYHLKKDEVC 121 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 23.8 bits (49), Expect = 5.3 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +3 Query: 24 QVLKYKVK*NEMKMTNLKN*VINWDETKWNGMRWTHNVRDTILD 155 Q K KVK E K L ++N DE K R + + +LD Sbjct: 667 QQTKMKVKRQEQKCKELTARLVNVDEEKVKFERSCRTIIEQLLD 710 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 724,027 Number of Sequences: 2352 Number of extensions: 14209 Number of successful extensions: 24 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -