BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0487.Seq (697 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 65 5e-13 M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-... 24 1.6 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 2.1 M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-... 23 3.7 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 22 6.4 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 21 8.5 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 65.3 bits (152), Expect = 5e-13 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = +1 Query: 502 IRRITNPQGKKRYIAAAFPSACGKTNLAMMTPTIAPGTK 618 I ITNP+GKKRYI AAFPSACGKTNLAMM PT+ PG K Sbjct: 1 ILAITNPKGKKRYITAAFPSACGKTNLAMMKPTL-PGYK 38 Score = 61.7 bits (143), Expect = 6e-12 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +3 Query: 606 PGYKVDCVGDDIAWMKFDKDGVFRAINPE 692 PGYK++CVGDDIAWMKFDK+G RAINPE Sbjct: 35 PGYKIECVGDDIAWMKFDKEGRLRAINPE 63 >M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E30. ). Length = 109 Score = 23.8 bits (49), Expect = 1.6 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -2 Query: 342 GRRANPECHRSRLREDNERTARLDVEFLELR 250 G+ +PE R R E+ ARL EF E R Sbjct: 13 GKNGSPEEKRPRTAFSAEQLARLKREFAENR 43 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 649 IQAMSSPTQSTLYPGQLLAS 590 I AMS ++ L PG+LL+S Sbjct: 901 IMAMSESSKKVLSPGELLSS 920 >M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E60. ). Length = 109 Score = 22.6 bits (46), Expect = 3.7 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 Query: 342 GRRANPECHRSRLREDNERTARLDVEFLELR 250 G PE R R E+ ARL EF E R Sbjct: 13 GNGGTPEEKRPRTAFSGEQLARLKREFAENR 43 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.8 bits (44), Expect = 6.4 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +3 Query: 123 WTHNVRDTIL 152 WTHNV D +L Sbjct: 163 WTHNVLDMVL 172 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 297 LHAVGSGGTPGWPCDPKNTII 359 LHA+ SG P +PK+T + Sbjct: 408 LHALTSGKCEHRPFEPKSTAV 428 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,977 Number of Sequences: 438 Number of extensions: 3755 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -