BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0478.Seq (697 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14329| Best HMM Match : RRM_1 (HMM E-Value=3.5e-05) 29 3.6 SB_22271| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_55853| Best HMM Match : Collagen (HMM E-Value=0.0035) 28 8.3 >SB_14329| Best HMM Match : RRM_1 (HMM E-Value=3.5e-05) Length = 365 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/39 (30%), Positives = 25/39 (64%) Frame = -2 Query: 696 KHVLETLGPVKVNEILSQKKVWFNRYSENRFFNSIGDAR 580 + + +T+GP K ++ S +W+N+Y+ +R + G+AR Sbjct: 6 RQLAQTVGPQKCDKPKSTYNIWYNKYTGDR--HKPGEAR 42 >SB_22271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 181 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = +3 Query: 6 THHLLQIVDYVGNAW-EEVVRCGGGKVRYYSE*GGRRPDTKRTVGSLLVI 152 T HL++ D V W +E +R G + R+ ++ G PDTK T+G ++++ Sbjct: 50 TKHLIKCKDAVWKRWTDEYLR--GLRERHRAKAGA--PDTKPTIGEVVIV 95 >SB_55853| Best HMM Match : Collagen (HMM E-Value=0.0035) Length = 453 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -3 Query: 248 ALDRFVRQFAAIRGTRNKTL*SCPPRGTRLPCYDKERSH 132 A DR + + IR RN C R +LPC D+ R + Sbjct: 410 AADRSEAEQSCIRLARNSPGNICDQRRNKLPCIDRRRGN 448 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,799,599 Number of Sequences: 59808 Number of extensions: 368915 Number of successful extensions: 807 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 739 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 807 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -