BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0478.Seq (697 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. 26 0.99 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 2.3 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 25 2.3 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 25 2.3 AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulf... 24 5.3 AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulf... 24 5.3 AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reduct... 24 5.3 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 7.0 >CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. Length = 295 Score = 26.2 bits (55), Expect = 0.99 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = -1 Query: 235 SCGSSRQFAALATKHFSPVHPGA 167 +CG+ ++ ++++ H P HPGA Sbjct: 210 TCGTGWKYRSISSLHAPPSHPGA 232 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.0 bits (52), Expect = 2.3 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 8/46 (17%) Frame = +3 Query: 117 DTKRTVGSLLVITRKPSAPG----WTGLKCF----VASAANCRELP 230 +T T+ + + KP+ G W G +C+ V S NCR+LP Sbjct: 1584 ETWATLAVRFLYSLKPNDNGMRFVWRGKECYLPCPVQSVTNCRQLP 1629 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 25.0 bits (52), Expect = 2.3 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -3 Query: 326 RRHTLHQCKNSNLKVSLTRLTFSRREALD 240 RR+ L KN+N S+ R F+ R LD Sbjct: 2431 RRYRLEYVKNTNKISSVYRTNFAARSGLD 2459 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 25.0 bits (52), Expect = 2.3 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -3 Query: 326 RRHTLHQCKNSNLKVSLTRLTFSRREALD 240 RR+ L KN+N S+ R F+ R LD Sbjct: 2432 RRYRLEYVKNTNKISSVYRTNFAARSGLD 2460 >AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 529 Score = 23.8 bits (49), Expect = 5.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 253 ARRSIGSCGSSRQFAALATKHFSPVHPGALG 161 ARR G +A +AT F+P+ G +G Sbjct: 384 ARRLFGGSEERMDYADVATTVFTPLEYGCVG 414 >AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 505 Score = 23.8 bits (49), Expect = 5.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 253 ARRSIGSCGSSRQFAALATKHFSPVHPGALG 161 ARR G +A +AT F+P+ G +G Sbjct: 360 ARRLFGGSEERMDYADVATTVFTPLEYGCVG 390 >AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reductase protein. Length = 502 Score = 23.8 bits (49), Expect = 5.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 253 ARRSIGSCGSSRQFAALATKHFSPVHPGALG 161 ARR G +A +AT F+P+ G +G Sbjct: 357 ARRLFGGSEERMDYADVATTVFTPLEYGCVG 387 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 23.4 bits (48), Expect = 7.0 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -1 Query: 214 FAALATKHFSPVHPGALGFLVMTRSDPTVRFVSGRRP 104 F+ LA + H A F+ + R D V+F+ +RP Sbjct: 1593 FSVLANDSYG-CHDRAHVFIYLIREDQRVKFILRQRP 1628 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 681,298 Number of Sequences: 2352 Number of extensions: 14314 Number of successful extensions: 23 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -