BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0478.Seq (697 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ277789-1|CAB93525.1| 1738|Drosophila melanogaster mismatch dep... 29 8.0 AE014135-90|AAF59338.1| 1738|Drosophila melanogaster CG1981-PA p... 29 8.0 >AJ277789-1|CAB93525.1| 1738|Drosophila melanogaster mismatch depedent uracil/thymineDNA glycosylase protein. Length = 1738 Score = 28.7 bits (61), Expect = 8.0 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +1 Query: 439 GDLLKRXRDTSAWTVPLRSTGQLGTKYS*RXTDTKKSPMMKTFKIKY 579 GD+L R S WT +GQ + +DTK+ PM + ++ Y Sbjct: 298 GDILIDDRRASLWTPHHDESGQRQQRTGTASSDTKQEPMNVSSELSY 344 >AE014135-90|AAF59338.1| 1738|Drosophila melanogaster CG1981-PA protein. Length = 1738 Score = 28.7 bits (61), Expect = 8.0 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +1 Query: 439 GDLLKRXRDTSAWTVPLRSTGQLGTKYS*RXTDTKKSPMMKTFKIKY 579 GD+L R S WT +GQ + +DTK+ PM + ++ Y Sbjct: 298 GDILIDDRRASLWTPHHDESGQRQQRTGTASSDTKQEPMNVSSELSY 344 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,123,574 Number of Sequences: 53049 Number of extensions: 560750 Number of successful extensions: 972 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 934 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 972 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3046624548 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -