BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0478.Seq (697 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 22 4.8 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 8.5 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 4.8 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = -2 Query: 666 KVNEILSQKKVWFNRYSENRFFNSIGDARILNFKRLHH 553 K +I+S N Y+ N +N+ + N+K+L + Sbjct: 77 KEPKIISNNNSLSNNYNYNNNYNNYNNNYNTNYKKLQY 114 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -3 Query: 248 ALDRFVRQFAAIRGTRNKTL*SCPPR 171 A+D+F R + G N+T+ C P+ Sbjct: 129 AIDKFDRLWVLDSGLVNRTVPVCAPK 154 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,717 Number of Sequences: 438 Number of extensions: 3353 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -