BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0477.Seq (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 2.4 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 5.5 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 5.5 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 5.5 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 7.3 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.0 bits (47), Expect = 2.4 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 Query: 574 SASFXXXAAGLGAPQXRTAPLPST 503 +ASF AAG G P+PST Sbjct: 188 TASFHHDAAGYGLRNYGPEPVPST 211 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.8 bits (44), Expect = 5.5 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = +2 Query: 320 VTLTAPIHGVDKILCIGLNYKDHCQEQNLTPP 415 + L+ P+ I G+ Y+D C PP Sbjct: 166 INLSVPVLLSGLIAMCGMYYRDECSFAESIPP 197 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 5.5 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = +2 Query: 320 VTLTAPIHGVDKILCIGLNYKDHCQEQNLTPP 415 + L+ P+ I G+ Y+D C PP Sbjct: 399 INLSVPVLLSGLIAMCGMYYRDECSFAESIPP 430 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 5.5 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = +2 Query: 320 VTLTAPIHGVDKILCIGLNYKDHCQEQNLTPP 415 + L+ P+ I G+ Y+D C PP Sbjct: 399 INLSVPVLLSGLIAMCGMYYRDECSFAESIPP 430 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 153 SPKNIRVGYLEGDDIVDINKADSSLPTTL 239 S K R Y DD+++ K + TTL Sbjct: 235 SKKKTRYYYRSVDDVIEKGKRPGAFRTTL 263 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,838 Number of Sequences: 336 Number of extensions: 3109 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -