BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0477.Seq (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g15510.1 68418.m01816 expressed protein 29 3.9 >At5g15510.1 68418.m01816 expressed protein Length = 497 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/49 (28%), Positives = 28/49 (57%) Frame = +3 Query: 45 ILSKSVNKIDIFLNTIRCFSVTKTRNMKLVQFSYKDSPKNIRVGYLEGD 191 + K +N ++ F + CFS +KT N + +D+ K +++ +LEG+ Sbjct: 195 VSGKVMNLVEAF-EKLTCFSNSKTANKIEENQTEEDTKKPVKLEFLEGE 242 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,105,032 Number of Sequences: 28952 Number of extensions: 267057 Number of successful extensions: 453 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 453 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -