BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0474.Seq (697 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45869| Best HMM Match : ANF_receptor (HMM E-Value=0) 31 1.2 SB_34614| Best HMM Match : FMO-like (HMM E-Value=0) 28 8.3 SB_24442| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_5256| Best HMM Match : EGF_2 (HMM E-Value=5.1) 28 8.3 >SB_45869| Best HMM Match : ANF_receptor (HMM E-Value=0) Length = 939 Score = 30.7 bits (66), Expect = 1.2 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 4/60 (6%) Frame = -3 Query: 431 PLAPARTRQLVFTISLFVTYVSVLPFITLSH--ALIIIFCFEWFY--FH*IHYILVAKKN 264 P+ A R+L + + + V P + L+ AL+ I C WFY + ILVAK N Sbjct: 658 PVVKASNRELCYILLFCIAMCYVAPAVYLAEPSALVCILCQMWFYLFYTTCIAILVAKTN 717 >SB_34614| Best HMM Match : FMO-like (HMM E-Value=0) Length = 475 Score = 27.9 bits (59), Expect = 8.3 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -1 Query: 88 LHYNYIADSFNTFTPLYNFYLYISYKT 8 +H++Y+ F+ F ++ Y YI Y+T Sbjct: 78 MHHSYVMKYFHLFARHFDLYKYIRYRT 104 >SB_24442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 673 Score = 27.9 bits (59), Expect = 8.3 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 82 YNYIADSFNTFTPLYNFYL 26 YNY D +N + +YN+YL Sbjct: 546 YNYYLDVYNYYLDIYNYYL 564 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 Query: 82 YNYIADSFNTFTPLYNFYLYISYK 11 YNY D +N + +YN+YL + K Sbjct: 588 YNYYLDVYNYYLDVYNYYLDVYNK 611 >SB_5256| Best HMM Match : EGF_2 (HMM E-Value=5.1) Length = 122 Score = 27.9 bits (59), Expect = 8.3 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 82 YNYIADSFNTFTPLYNFYL 26 YNY D +N + +YN+YL Sbjct: 9 YNYYLDVYNYYLDIYNYYL 27 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 Query: 82 YNYIADSFNTFTPLYNFYLYISYK 11 YNY D +N + +YN+YL + K Sbjct: 72 YNYYLDVYNYYLDVYNYYLDVYNK 95 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,793,676 Number of Sequences: 59808 Number of extensions: 273607 Number of successful extensions: 437 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 398 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 435 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -