BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0471.Seq (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 28 0.084 AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical pro... 25 0.59 AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory recept... 24 1.0 AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory recept... 24 1.0 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 27.9 bits (59), Expect = 0.084 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 8/65 (12%) Frame = -2 Query: 493 NFSQFFYGYYIT*YLLCSSSFSL----WFYQ*GAVFA----IIGGFIN*YPLFTGLSLNS 338 + S+ FYG+ I +LL F L W + G A ++ F+ YPLF L +++ Sbjct: 109 DLSRTFYGFVIVAHLLFLVIFVLNIWCWIVEIGGWLAFTKQLLIKFVEVYPLFVLLIVSN 168 Query: 337 YILKI 323 +LKI Sbjct: 169 VVLKI 173 >AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical protein protein. Length = 102 Score = 25.0 bits (52), Expect = 0.59 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -2 Query: 508 RINRCNFSQFFYGYYIT*YLLCSSSFSL 425 R N NFS+F +Y + +LL SSS L Sbjct: 13 RTNGSNFSKFINCHYTSGHLLGSSSLPL 40 >AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory receptor candidate 44 protein. Length = 313 Score = 24.2 bits (50), Expect = 1.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 208 FHEIYESG*SEYRRGIQLNLKNVV 279 FH IYE+ Y+ GIQ ++ N V Sbjct: 141 FHLIYEAHGFSYKCGIQYHICNTV 164 >AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory receptor candidate 4 protein. Length = 309 Score = 24.2 bits (50), Expect = 1.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 208 FHEIYESG*SEYRRGIQLNLKNVV 279 FH IYE+ Y+ GIQ ++ N V Sbjct: 137 FHLIYEAHGFSYKCGIQYHICNTV 160 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,402 Number of Sequences: 336 Number of extensions: 3041 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -