BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0471.Seq (698 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006743-1|AAF60503.1| 255|Caenorhabditis elegans Hypothetical ... 29 2.4 AF039710-7|AAB96687.1| 123|Caenorhabditis elegans Hypothetical ... 29 3.2 >AC006743-1|AAF60503.1| 255|Caenorhabditis elegans Hypothetical protein Y38C1BA.1 protein. Length = 255 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/57 (22%), Positives = 27/57 (47%) Frame = -1 Query: 410 GSSICNYWGIY*LISFIYRPFIKFLYTKNSIFYNIYWSKYNIFSTTFFRFSWIPRRY 240 G ++CN W ++ + I+ FI +N F ++W+ + T W+P+ + Sbjct: 48 GHALCNIWWLWFIYQCIHIIFIHTRIFQNCNF--MFWATVKTITYTIDFLIWVPKEF 102 >AF039710-7|AAB96687.1| 123|Caenorhabditis elegans Hypothetical protein C46E10.2 protein. Length = 123 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 317 FYNIYWSKYNIFSTTF 270 F+NIYWS Y IF TF Sbjct: 11 FFNIYWSFYAIFGFTF 26 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,557,626 Number of Sequences: 27780 Number of extensions: 248530 Number of successful extensions: 500 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 490 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 500 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -