BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0471.Seq (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 2.8 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 2.8 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 22 6.4 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 22 6.4 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 21 8.5 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 21 8.5 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = -2 Query: 301 GVNITFFPQHFLGLAGYLDDIQIIQTHIFHEI 206 G ++T + H+ G LD++Q+ + HE+ Sbjct: 1431 GASLTGYTLHYRTAHGNLDELQLSRHATSHEL 1462 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = -2 Query: 301 GVNITFFPQHFLGLAGYLDDIQIIQTHIFHEI 206 G ++T + H+ G LD++Q+ + HE+ Sbjct: 1427 GASLTGYTLHYRTAHGNLDELQLSRHATSHEL 1458 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 589 SSKNFNSXWDRHNYSS*SKYARGIHIHTLP 678 SS N+N +NY+S Y I+I +P Sbjct: 305 SSNNYNYKNYNNNYNSKKLYYNIINIEQIP 334 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 6.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 589 SSKNFNSXWDRHNYSS*SKYARGIHIHTLP 678 SS N+N +NY+S Y I+I +P Sbjct: 316 SSNNYNYKNYNNNYNSKKLYYNIINIEQIP 345 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = -2 Query: 97 SHHQLNDIKIYHQQNIHIM 41 SHH L+ ++ +QQ+ ++M Sbjct: 72 SHHHLHHHQVLYQQSPYLM 90 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 Query: 284 FSTTFFRFSWIPRRYSDY 231 ++T FFR+ P YS++ Sbjct: 242 YNTKFFRYRITPELYSEH 259 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,849 Number of Sequences: 438 Number of extensions: 3414 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -