BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0470.Seq (698 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0111 - 27752339-27752777,27753356-27753840,27753956-27754120 50 1e-06 05_01_0411 + 3243025-3243092,3243348-3243496,3243740-3243872,324... 43 2e-04 02_05_0183 + 26537676-26537752,26538481-26538649,26538736-265389... 43 3e-04 05_01_0207 + 1493224-1493385,1493475-1493839,1494313-1494390,149... 42 4e-04 02_02_0600 + 12018256-12018502,12018943-12019073,12019104-12019553 42 5e-04 01_01_0976 + 7711634-7711801,7712741-7713183,7715813-7716251 42 5e-04 08_01_0408 - 3616655-3617108,3617190-3617596,3618120-3618287 41 8e-04 04_04_0712 + 27476319-27476569,27477150-27477402,27477535-274779... 41 0.001 02_01_0713 - 5332145-5332351,5332675-5332893,5334347-5334559,533... 40 0.001 01_07_0380 + 43181564-43181639,43182053-43182218,43182494-431826... 40 0.001 03_05_0497 + 24932336-24932485,24934037-24934199,24934306-249344... 40 0.002 08_02_0469 - 17531189-17531678,17531773-17531798,17533511-17533669 39 0.003 01_06_0406 + 29113033-29113119,29113250-29113309,29114104-291141... 39 0.004 06_03_0151 + 17270688-17270698,17271149-17271281,17271548-172715... 38 0.006 03_06_0226 + 32495088-32495237,32496189-32496351,32496438-324965... 38 0.008 03_02_0704 - 10542187-10542339,10542466-10542522,10542667-105427... 38 0.010 05_06_0267 - 26784861-26784896,26785324-26785404,26785530-267857... 37 0.013 05_03_0564 - 15502458-15503303,15503394-15503474,15503572-155036... 37 0.013 05_03_0563 - 15493570-15494415,15494506-15494586,15494684-154947... 37 0.013 05_03_0562 - 15484733-15485578,15485669-15485749,15485847-154858... 37 0.013 03_02_0650 + 10174905-10175000,10175321-10175376,10175467-101755... 36 0.023 02_01_0225 - 1469295-1469733,1472352-1472767,1473603-1473658,147... 36 0.023 06_01_0120 - 926226-926289,926821-926887,927122-927170,927257-92... 36 0.031 08_02_1300 + 25972496-25972582,25972664-25972723,25973786-259738... 36 0.041 05_04_0027 - 17298727-17299830 36 0.041 02_05_1130 - 34319558-34319603,34320236-34320335,34320498-343205... 36 0.041 02_05_0821 - 32019775-32019882,32020296-32020352,32020614-320206... 35 0.054 06_01_0667 + 4878784-4878900,4879016-4879118,4879256-4879341,487... 35 0.071 09_04_0594 - 18831011-18831360,18831562-18832111,18832364-188334... 34 0.094 06_01_0929 - 7171395-7171676,7172019-7172219,7172438-7172524,717... 34 0.094 05_04_0387 - 20834510-20834978,20836866-20837329,20837458-20837634 34 0.094 12_01_0915 - 8908643-8908756,8909086-8909203,8909570-8909682,891... 34 0.12 12_01_0438 + 3455686-3455692,3456149-3456240,3457422-3457505,345... 34 0.12 01_06_1526 + 38003071-38003247,38003338-38003690,38004489-38004987 33 0.16 02_04_0220 - 21014225-21014386,21014492-21014572,21014739-210149... 33 0.22 02_01_0717 + 5351504-5351602,5353401-5353499,5353574-5353675,535... 33 0.22 01_05_0327 + 20984336-20985478 33 0.22 02_05_0699 + 31013176-31013345,31013749-31013872,31013950-310140... 33 0.29 04_03_0735 + 19141038-19143227 32 0.50 02_05_0381 - 28483425-28483458,28483588-28483658,28483746-284838... 32 0.50 01_01_0013 + 81507-81932,82718-82864 32 0.50 02_03_0378 + 18327622-18329826 31 0.67 01_05_0090 + 18038219-18038421,18039365-18039488,18040229-180403... 31 0.67 12_02_0426 - 18959301-18959396,18959593-18959727,18959821-189599... 31 0.88 06_03_0339 - 19687749-19690805 31 0.88 06_01_0806 - 6048042-6048138,6048461-6048550,6049362-6049425,604... 31 0.88 05_06_0167 - 26104527-26104567,26105130-26105226,26105377-261054... 31 0.88 01_06_0592 + 30465956-30466210,30466401-30466529,30466631-304667... 31 0.88 01_05_0646 + 23907837-23907956,23908077-23908164,23908282-239083... 31 0.88 12_02_0454 + 19199063-19200757,19202201-19202287 31 1.2 08_02_0878 + 22152437-22152532,22152619-22152718,22152907-221529... 31 1.2 12_02_1140 + 26411424-26411998,26412491-26412761,26412848-26413405 30 1.5 12_01_0724 - 6377023-6379392 30 1.5 07_03_1759 + 29285262-29287208 30 1.5 04_03_0283 + 13887388-13887573,13887711-13887806,13888517-138886... 30 1.5 03_02_0205 + 6389343-6389609,6390418-6390486,6390662-6390757,639... 30 1.5 03_02_0845 - 11700830-11701327 30 2.0 06_03_0032 - 15697530-15697669,15699215-15699437,15699823-156999... 29 2.7 01_01_1211 + 9753518-9753894,9754265-9754313,9754747-9754773 29 2.7 10_08_1023 - 22341815-22342042,22342179-22342247,22342717-223428... 29 4.7 02_05_0971 - 33188816-33188965,33190406-33190705,33191500-331915... 29 4.7 06_02_0121 + 12080417-12081632,12082428-12082780,12082844-12083776 28 6.2 04_04_1571 + 34504087-34504421,34505002-34505731,34506091-345120... 28 6.2 02_03_0273 + 17173983-17174339,17174423-17174575,17174638-171747... 28 6.2 01_01_1212 + 9763949-9764412,9765183-9765252,9765356-9765457 28 6.2 08_02_1491 + 27500532-27500972 28 8.2 04_04_0645 + 26913947-26915783,26915833-26916308,26916372-26917220 28 8.2 03_06_0554 + 34691050-34691242,34691327-34691394,34691754-34692275 28 8.2 03_03_0278 - 16126803-16129049 28 8.2 03_02_0727 - 10742899-10744375,10744470-10744933,10745412-10745477 28 8.2 03_02_0330 + 7502593-7504956,7505020-7506312,7522011-7522235 28 8.2 01_06_1164 - 35026345-35026954,35027853-35027939,35028120-350284... 28 8.2 01_01_1190 + 9463973-9465732,9466210-9466440,9467664-9467793,946... 28 8.2 >05_07_0111 - 27752339-27752777,27753356-27753840,27753956-27754120 Length = 362 Score = 50.4 bits (115), Expect = 1e-06 Identities = 28/72 (38%), Positives = 42/72 (58%) Frame = +3 Query: 426 VDYYRVLGVTRTATDTEIKKAYRKTSTEWAS**KS*XF**S*SKIPRNF*SL*GSSDEXK 605 +DYY++LGV + A+D ++KKAYRK + +W + +K + + SD K Sbjct: 3 MDYYKILGVDKAASDDDLKKAYRKLAMKWHPDKNPNNKKEAENKFKQISEAYEVLSDPQK 62 Query: 606 RRVYDQYGKEXL 641 R VYDQYG+E L Sbjct: 63 RAVYDQYGEEGL 74 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/30 (60%), Positives = 23/30 (76%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 A+ HPDKNP+ EA +F++ISEAYEVL Sbjct: 28 AMKWHPDKNPNNKKEAENKFKQISEAYEVL 57 >05_01_0411 + 3243025-3243092,3243348-3243496,3243740-3243872, 3244740-3244860,3245065-3245181,3245303-3245389, 3245941-3246000,3246097-3246174,3246587-3246658, 3246767-3246925 Length = 347 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/30 (63%), Positives = 25/30 (83%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 AL HPDKNP+ ++EAN+RF EI+ AYE+L Sbjct: 49 ALKYHPDKNPN-NEEANKRFAEINNAYEIL 77 Score = 31.9 bits (69), Expect = 0.50 Identities = 21/70 (30%), Positives = 40/70 (57%) Frame = +3 Query: 432 YYRVLGVTRTATDTEIKKAYRKTSTEWAS**KS*XF**S*SKIPRNF*SL*GSSDEXKRR 611 YY VL V + A++ +IK++YRK + ++ K+ + + + +D+ KR+ Sbjct: 26 YYDVLQVPKGASEDQIKRSYRKLALKYHP-DKNPNNEEANKRFAEINNAYEILTDQEKRK 84 Query: 612 VYDQYGKEXL 641 +YD+YG+E L Sbjct: 85 IYDRYGEEGL 94 >02_05_0183 + 26537676-26537752,26538481-26538649,26538736-26538910, 26539008-26539137,26540425-26540558,26540629-26540771, 26540894-26541092,26541183-26541514 Length = 452 Score = 42.7 bits (96), Expect = 3e-04 Identities = 29/77 (37%), Positives = 39/77 (50%), Gaps = 4/77 (5%) Frame = +3 Query: 432 YYRVLGVTRTATDTEIKKAYRKTSTEWAS**KS*XF**S*SKIPRNF*SL*GS----SDE 599 YY VLGV++TAT E+KKAYRK + + P F L + +D Sbjct: 46 YYEVLGVSKTATQDELKKAYRKAAIKNHP---------DKGGDPEKFKELAQAYEVLNDP 96 Query: 600 XKRRVYDQYGKEXLNNG 650 KR +YDQYG++ L G Sbjct: 97 EKREIYDQYGEDALKEG 113 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 A+ HPDK D +F+E+++AYEVL Sbjct: 69 AIKNHPDKGGDPE-----KFKELAQAYEVL 93 >05_01_0207 + 1493224-1493385,1493475-1493839,1494313-1494390, 1496134-1496157,1496213-1496654 Length = 356 Score = 42.3 bits (95), Expect = 4e-04 Identities = 31/87 (35%), Positives = 48/87 (55%) Frame = +3 Query: 426 VDYYRVLGVTRTATDTEIKKAYRKTSTEWAS**KS*XF**S*SKIPRNF*SL*GSSDEXK 605 +DYY+VLGV R ATD E+K++YR+ + + K+ S + + SD K Sbjct: 3 LDYYKVLGVGRGATDEELKRSYRRLAMKHHP-DKNRSPHADDSLFKQVSEAYDVLSDPQK 61 Query: 606 RRVYDQYGKEXLNNGRVVALPQTRTTN 686 R +YDQ+G+E L G A P T +++ Sbjct: 62 RAIYDQFGEEGLKAG--AAPPPTTSSS 86 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 A+ HPDKN + + F+++SEAY+VL Sbjct: 28 AMKHHPDKNRSPHAD-DSLFKQVSEAYDVL 56 >02_02_0600 + 12018256-12018502,12018943-12019073,12019104-12019553 Length = 275 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/29 (58%), Positives = 23/29 (79%) Frame = +3 Query: 426 VDYYRVLGVTRTATDTEIKKAYRKTSTEW 512 VDYY++L V R AT+ E+KKAYRK + +W Sbjct: 3 VDYYKLLQVERGATEEELKKAYRKLAMKW 31 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEV 588 A+ HPDKNP+ EA +F++ISEAYEV Sbjct: 28 AMKWHPDKNPNSKKEAEAKFKQISEAYEV 56 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +3 Query: 591 SDEXKRRVYDQYGKEXL 641 SD KR VYDQYG+E L Sbjct: 129 SDSQKRAVYDQYGEEGL 145 >01_01_0976 + 7711634-7711801,7712741-7713183,7715813-7716251 Length = 349 Score = 41.9 bits (94), Expect = 5e-04 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 1/73 (1%) Frame = +3 Query: 426 VDYYRVLGVTRTATDTEIKKAYRKTSTEW-AS**KS*XF**S*SKIPRNF*SL*GSSDEX 602 VDYY+VLGV R A D ++KKAY K + W + + +K + + SD Sbjct: 3 VDYYKVLGVDRGAGDDDLKKAYHKLAMRWHPDKNPTNNKKEAEAKFKQISEAYEVLSDPQ 62 Query: 603 KRRVYDQYGKEXL 641 KR +YDQ G+E L Sbjct: 63 KRTIYDQVGEEGL 75 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +1 Query: 502 ALNGHPDKNP-DXSDEANRRFQEISEAYEVL 591 A+ HPDKNP + EA +F++ISEAYEVL Sbjct: 28 AMRWHPDKNPTNNKKEAEAKFKQISEAYEVL 58 >08_01_0408 - 3616655-3617108,3617190-3617596,3618120-3618287 Length = 342 Score = 41.1 bits (92), Expect = 8e-04 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 4/76 (5%) Frame = +3 Query: 426 VDYYRVLGVTRTATDTEIKKAYRKTSTEW----AS**KS*XF**S*SKIPRNF*SL*GSS 593 +DYY VL V R AT+ ++KK+YR+ + +W K KI + L S Sbjct: 3 MDYYNVLKVNRNATEEDLKKSYRRMAMKWHPDKNPGDKKKEAEAKFKKISEAYEVL---S 59 Query: 594 DEXKRRVYDQYGKEXL 641 D KR +YD+YG+E L Sbjct: 60 DPQKRAIYDKYGEEGL 75 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +1 Query: 502 ALNGHPDKNP-DXSDEANRRFQEISEAYEVL 591 A+ HPDKNP D EA +F++ISEAYEVL Sbjct: 28 AMKWHPDKNPGDKKKEAEAKFKKISEAYEVL 58 >04_04_0712 + 27476319-27476569,27477150-27477402,27477535-27477914, 27479738-27479864,27479945-27480110,27480221-27480359, 27481854-27481987,27482087-27482229,27482367-27482565, 27482688-27483010 Length = 704 Score = 40.7 bits (91), Expect = 0.001 Identities = 29/85 (34%), Positives = 42/85 (49%), Gaps = 4/85 (4%) Frame = +3 Query: 408 GRDTAMVDYYRVLGVTRTATDTEIKKAYRKTSTEWAS**KS*XF**S*SKIPRNF*SL*G 587 G ++ YY VLGV +TA+ E+KKAYRK + + P F L Sbjct: 293 GMESNNTKYYEVLGVPKTASKDELKKAYRKAAIKNHP---------DKGGDPEKFKELSQ 343 Query: 588 S----SDEXKRRVYDQYGKEXLNNG 650 + +D KR +YDQYG++ L +G Sbjct: 344 AYEVLTDPEKRDIYDQYGEDALKDG 368 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 A+ HPDK D +F+E+S+AYEVL Sbjct: 324 AIKNHPDKGGDPE-----KFKELSQAYEVL 348 >02_01_0713 - 5332145-5332351,5332675-5332893,5334347-5334559, 5334637-5334730,5334860-5335020,5335114-5335315, 5335619-5335784,5336208-5336286 Length = 446 Score = 40.3 bits (90), Expect = 0.001 Identities = 13/28 (46%), Positives = 24/28 (85%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTSTEW 512 D+Y++LG+++TA+ EIK+AY+K + +W Sbjct: 327 DWYKILGISKTASAAEIKRAYKKLALQW 354 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 AL HPDKN D +EA F+EI+ AYEVL Sbjct: 351 ALQWHPDKNVDKREEAENMFREIAAAYEVL 380 >01_07_0380 + 43181564-43181639,43182053-43182218,43182494-43182695, 43182789-43182949,43183079-43183172,43183250-43183462, 43184917-43185135,43185458-43185661 Length = 444 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 AL HPDKN D +EA F+EI+ AYEVL Sbjct: 350 ALQWHPDKNVDNREEAENMFREIAAAYEVL 379 Score = 39.1 bits (87), Expect = 0.003 Identities = 12/28 (42%), Positives = 24/28 (85%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTSTEW 512 D+Y++LG+++TA+ +IK+AY+K + +W Sbjct: 326 DWYKILGISKTASAADIKRAYKKLALQW 353 >03_05_0497 + 24932336-24932485,24934037-24934199,24934306-24934447, 24934528-24934804,24934887-24935085,24935169-24935491 Length = 417 Score = 39.9 bits (89), Expect = 0.002 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 4/77 (5%) Frame = +3 Query: 432 YYRVLGVTRTATDTEIKKAYRKTSTEWAS**KS*XF**S*SKIPRNF*SL*GS----SDE 599 YY +LGV +TA+ ++KKAYRK + + P F L + SD Sbjct: 14 YYEILGVPKTASQDDLKKAYRKAAIKNHP---------DKGGDPEKFKELAQAYEVLSDP 64 Query: 600 XKRRVYDQYGKEXLNNG 650 KR +YDQYG++ L G Sbjct: 65 EKREIYDQYGEDALKEG 81 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 A+ HPDK D +F+E+++AYEVL Sbjct: 37 AIKNHPDKGGDPE-----KFKELAQAYEVL 61 >08_02_0469 - 17531189-17531678,17531773-17531798,17533511-17533669 Length = 224 Score = 39.1 bits (87), Expect = 0.003 Identities = 14/29 (48%), Positives = 22/29 (75%) Frame = +3 Query: 426 VDYYRVLGVTRTATDTEIKKAYRKTSTEW 512 +DYY +L V R+ATD +I++AYR+ + W Sbjct: 1 MDYYEILHVDRSATDDDIRRAYRRLAMRW 29 Score = 33.5 bits (73), Expect = 0.16 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVLQM 597 A+ HPDKN +A +F++I+EAY + + Sbjct: 26 AMRWHPDKNHTGKKDAEAKFKDITEAYNIFDL 57 >01_06_0406 + 29113033-29113119,29113250-29113309,29114104-29114186, 29114394-29114556,29114695-29114824,29115016-29115174, 29115295-29115464,29115590-29115670,29116492-29116536, 29116597-29117346,29117424-29117654 Length = 652 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/26 (61%), Positives = 21/26 (80%) Frame = +1 Query: 514 HPDKNPDXSDEANRRFQEISEAYEVL 591 HPDKNP+ D A RRF+E+ EAY++L Sbjct: 34 HPDKNPNNPD-AERRFKELGEAYQIL 58 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +3 Query: 432 YYRVLGVTRTATDTEIKKAY 491 YY VLGV+ A+ EIKKAY Sbjct: 7 YYDVLGVSTDASAAEIKKAY 26 >06_03_0151 + 17270688-17270698,17271149-17271281,17271548-17271589, 17271706-17271815,17271957-17272035,17272114-17272287, 17272386-17272466,17272761-17272988,17273067-17273402, 17273501-17273586,17273642-17273783,17274596-17274687, 17274770-17274904,17275142-17275304,17275393-17275482, 17275568-17275753,17276109-17276141,17276700-17276762, 17276839-17276901,17276983-17277042,17277258-17277410, 17277530-17277613,17278434-17278610,17278685-17278791, 17278858-17279071,17279158-17279261,17279926-17280061, 17280191-17280316,17280682-17280792,17280968-17281066, 17281367-17281633,17281707-17281822,17281853-17282084, 17282597-17282664,17282682-17282807,17282980-17283040 Length = 1495 Score = 38.3 bits (85), Expect = 0.006 Identities = 18/29 (62%), Positives = 21/29 (72%) Frame = +3 Query: 411 RDTAMVDYYRVLGVTRTATDTEIKKAYRK 497 R A DYY+VLGVT +T EIK+AYRK Sbjct: 1434 RGKAREDYYQVLGVTVNSTPQEIKEAYRK 1462 >03_06_0226 + 32495088-32495237,32496189-32496351,32496438-32496576, 32496669-32496945,32497051-32497249,32497379-32497704 Length = 417 Score = 37.9 bits (84), Expect = 0.008 Identities = 27/77 (35%), Positives = 37/77 (48%), Gaps = 4/77 (5%) Frame = +3 Query: 432 YYRVLGVTRTATDTEIKKAYRKTSTEWAS**KS*XF**S*SKIPRNF*SL*GS----SDE 599 YY VLGV + A+ ++KKAYRK + + P F L + SD Sbjct: 14 YYEVLGVPKDASQDDLKKAYRKAAIKNHP---------DKGGDPEKFKELAQAYEVLSDP 64 Query: 600 XKRRVYDQYGKEXLNNG 650 KR +YDQYG++ L G Sbjct: 65 EKREIYDQYGEDALKEG 81 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 A+ HPDK D +F+E+++AYEVL Sbjct: 37 AIKNHPDKGGDPE-----KFKELAQAYEVL 61 >03_02_0704 - 10542187-10542339,10542466-10542522,10542667-10542737, 10542823-10542901,10543021-10543161 Length = 166 Score = 37.5 bits (83), Expect = 0.010 Identities = 17/30 (56%), Positives = 19/30 (63%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 A+ HPD+ EANRRFQ I EAY VL Sbjct: 46 AMKWHPDRCVSDPGEANRRFQRIQEAYSVL 75 Score = 32.7 bits (71), Expect = 0.29 Identities = 10/27 (37%), Positives = 20/27 (74%) Frame = +3 Query: 432 YYRVLGVTRTATDTEIKKAYRKTSTEW 512 YY +LG+ + A+ T+++ AYR+ + +W Sbjct: 23 YYSLLGIRKNASATDVRAAYRRLAMKW 49 >05_06_0267 - 26784861-26784896,26785324-26785404,26785530-26785702, 26785780-26785938,26786199-26786328,26786447-26786609, 26787027-26787109,26787605-26787664,26787819-26787940, 26789126-26789275,26789354-26789546,26790156-26790393, 26791240-26791320,26791403-26791647 Length = 637 Score = 37.1 bits (82), Expect = 0.013 Identities = 18/42 (42%), Positives = 23/42 (54%) Frame = +1 Query: 514 HPDKNPDXSDEANRRFQEISEAYEVLQMRXNAECMTSTARXG 639 HPDKNP D A ++FQE+ EAY+VL E + G Sbjct: 348 HPDKNPGNPDAA-QKFQELGEAYQVLSDPSKREAYDKHGKEG 388 Score = 29.5 bits (63), Expect = 2.7 Identities = 28/83 (33%), Positives = 39/83 (46%) Frame = +3 Query: 411 RDTAMVDYYRVLGVTRTATDTEIKKAYRKTSTEWAS**KS*XF**S*SKIPRNF*SL*GS 590 +DTA YY LGV+ A+ EIKKAY + + K+ + K + Sbjct: 317 KDTA---YYDTLGVSVDASPAEIKKAYYLKAKQ-VHPDKNPGNPDAAQKFQELGEAYQVL 372 Query: 591 SDEXKRRVYDQYGKEXLNNGRVV 659 SD KR YD++GKE L +V Sbjct: 373 SDPSKREAYDKHGKEGLPQDNMV 395 >05_03_0564 - 15502458-15503303,15503394-15503474,15503572-15503620, 15503786-15503828,15504576-15504633,15504720-15504858, 15504980-15505107 Length = 447 Score = 37.1 bits (82), Expect = 0.013 Identities = 27/75 (36%), Positives = 38/75 (50%), Gaps = 1/75 (1%) Frame = +3 Query: 420 AMVDYYRVLGVTRTATDTEIKKAYRKTSTEW-AS**KS*XF**S*SKIPRNF*SL*GSSD 596 A D+Y LGV+R A+ +EIK AYRK + + K I + L SD Sbjct: 87 ADADFYSTLGVSRNASKSEIKSAYRKLARSYHPDVNKDPGAEQKFKDISNAYEVL---SD 143 Query: 597 EXKRRVYDQYGKEXL 641 + KR +YD+YG+ L Sbjct: 144 DEKRSIYDKYGEAGL 158 >05_03_0563 - 15493570-15494415,15494506-15494586,15494684-15494732, 15494898-15494940,15495688-15495745,15495832-15495970, 15496092-15496219 Length = 447 Score = 37.1 bits (82), Expect = 0.013 Identities = 27/75 (36%), Positives = 38/75 (50%), Gaps = 1/75 (1%) Frame = +3 Query: 420 AMVDYYRVLGVTRTATDTEIKKAYRKTSTEW-AS**KS*XF**S*SKIPRNF*SL*GSSD 596 A D+Y LGV+R A+ +EIK AYRK + + K I + L SD Sbjct: 87 ADADFYSTLGVSRNASKSEIKSAYRKLARSYHPDVNKDPGAEQKFKDISNAYEVL---SD 143 Query: 597 EXKRRVYDQYGKEXL 641 + KR +YD+YG+ L Sbjct: 144 DEKRSIYDKYGEAGL 158 >05_03_0562 - 15484733-15485578,15485669-15485749,15485847-15485895, 15486061-15486103,15486851-15486908,15486995-15487133, 15487255-15487382 Length = 447 Score = 37.1 bits (82), Expect = 0.013 Identities = 27/75 (36%), Positives = 38/75 (50%), Gaps = 1/75 (1%) Frame = +3 Query: 420 AMVDYYRVLGVTRTATDTEIKKAYRKTSTEW-AS**KS*XF**S*SKIPRNF*SL*GSSD 596 A D+Y LGV+R A+ +EIK AYRK + + K I + L SD Sbjct: 87 ADADFYSTLGVSRNASKSEIKSAYRKLARSYHPDVNKDPGAEQKFKDISNAYEVL---SD 143 Query: 597 EXKRRVYDQYGKEXL 641 + KR +YD+YG+ L Sbjct: 144 DEKRSIYDKYGEAGL 158 >03_02_0650 + 10174905-10175000,10175321-10175376,10175467-10175540, 10176215-10176753,10176845-10177186,10177520-10177879, 10177982-10178193,10178881-10179169,10179469-10180152 Length = 883 Score = 36.3 bits (80), Expect = 0.023 Identities = 28/76 (36%), Positives = 42/76 (55%), Gaps = 1/76 (1%) Frame = +3 Query: 426 VDYYRVLGVTRTATDTEIKKAYRKTSTEW-AS**KS*XF**S*SKIPRNF*SL*GSSDEX 602 +D Y+VLGV ++A+ +I+KA+ K S ++ KS ++I + L SDE Sbjct: 28 LDPYKVLGVDKSASQRDIQKAFHKLSLKYHPDKNKSKGAQEKFAEINNAYDIL---SDEE 84 Query: 603 KRRVYDQYGKEXLNNG 650 KR+ YD YG E N G Sbjct: 85 KRKNYDLYGDEKGNPG 100 >02_01_0225 - 1469295-1469733,1472352-1472767,1473603-1473658, 1473827-1473995 Length = 359 Score = 36.3 bits (80), Expect = 0.023 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = +1 Query: 514 HPDKNPDXSDEANRRFQEISEAYE 585 HPDKNP EA +F++I+EAYE Sbjct: 32 HPDKNPTGGAEAEAKFKQITEAYE 55 Score = 35.1 bits (77), Expect = 0.054 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +3 Query: 426 VDYYRVLGVTRTATDTEIKKAYRKTSTEW 512 +DYY +L V R AT ++KK+YR+ + W Sbjct: 3 MDYYNILKVNRNATLEDLKKSYRRLARTW 31 >06_01_0120 - 926226-926289,926821-926887,927122-927170,927257-927313, 927826-927897,928145-928236,928331-928403,928870-928944, 929207-929314,929372-929422,929834-929959,930324-930362, 930452-930535,931018-931109,931217-931300,931410-931524 Length = 415 Score = 35.9 bits (79), Expect = 0.031 Identities = 17/27 (62%), Positives = 19/27 (70%) Frame = +3 Query: 411 RDTAMVDYYRVLGVTRTATDTEIKKAY 491 R A DYY VLGV+R A+ EIKKAY Sbjct: 69 RPVAARDYYDVLGVSRNASQGEIKKAY 95 Score = 33.5 bits (73), Expect = 0.16 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = +1 Query: 514 HPDKNPDXSDEANRRFQEISEAYEVLQ 594 HPD N SD A R+FQE+ AYE L+ Sbjct: 103 HPDTNKGDSD-AERKFQEVQRAYETLK 128 >08_02_1300 + 25972496-25972582,25972664-25972723,25973786-25973868, 25974120-25974166,25975194-25975352,25975466-25975644, 25975738-25975818,25975903-25976046,25976246-25976347 Length = 313 Score = 35.5 bits (78), Expect = 0.041 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = +1 Query: 514 HPDKNPDXSDEANRRFQEISEAYEVLQMRXNAECMTSTARXG*ITEG 654 HPDKNP+ +A FQ + EAY+VL + + + G TEG Sbjct: 34 HPDKNPN-DPKAAENFQALGEAYQVLSDPTQRQAYDAHGKSGISTEG 79 Score = 34.7 bits (76), Expect = 0.071 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = +3 Query: 432 YYRVLGVTRTATDTEIKKAY 491 YY VLGV+ TAT++EIKKAY Sbjct: 7 YYDVLGVSPTATESEIKKAY 26 >05_04_0027 - 17298727-17299830 Length = 367 Score = 35.5 bits (78), Expect = 0.041 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTS 503 DYY +LGV R+ + EI+KAYRK S Sbjct: 106 DYYAILGVERSCSVEEIRKAYRKLS 130 >02_05_1130 - 34319558-34319603,34320236-34320335,34320498-34320577, 34320680-34320840,34321602-34321731,34322055-34322230, 34322873-34323068,34323768-34323889,34324376-34324468, 34324672-34324740,34325259-34325423,34325771-34326061 Length = 542 Score = 35.5 bits (78), Expect = 0.041 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +3 Query: 420 AMVDYYRVLGVTRTATDTEIKKAYRKTSTE 509 A DYY LGV R+A++ +IK AYRK + + Sbjct: 68 ASADYYATLGVPRSASNKDIKAAYRKLARQ 97 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 514 HPDKNPDXSDEANRRFQEISEAYEVL 591 HPD N + A +F+EIS AYEVL Sbjct: 154 HPDVNKEPG--ATDKFKEISAAYEVL 177 >02_05_0821 - 32019775-32019882,32020296-32020352,32020614-32020687, 32021508-32021583,32021796-32021873,32022130-32022228 Length = 163 Score = 35.1 bits (77), Expect = 0.054 Identities = 17/30 (56%), Positives = 20/30 (66%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 AL HPDK + A RFQEI+EAY+VL Sbjct: 58 ALKWHPDKK-QGEENATSRFQEINEAYQVL 86 >06_01_0667 + 4878784-4878900,4879016-4879118,4879256-4879341, 4879434-4879496,4879589-4879831,4880639-4880728, 4881403-4881600 Length = 299 Score = 34.7 bits (76), Expect = 0.071 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +3 Query: 408 GRDTAMVDYYRVLGVTRTATDTEIKKAYRKTSTEW 512 G A D Y VLG++R TD +++ AYRK + W Sbjct: 7 GGGGADADLYAVLGLSRECTDADLRLAYRKLAMIW 41 >09_04_0594 - 18831011-18831360,18831562-18832111,18832364-18833406, 18833496-18833760,18835194-18835340,18835431-18835511, 18835626-18835804,18835935-18836093,18836269-18836398, 18836935-18837094,18837337-18837419,18837865-18837915, 18838035-18838151,18838273-18838359 Length = 1133 Score = 34.3 bits (75), Expect = 0.094 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +3 Query: 432 YYRVLGVTRTATDTEIKKAY 491 YY VLGV+ TAT+ EIKKAY Sbjct: 7 YYDVLGVSPTATEVEIKKAY 26 >06_01_0929 - 7171395-7171676,7172019-7172219,7172438-7172524, 7172973-7173023,7173883-7173987,7174074-7174185, 7174284-7174366,7174434-7174557,7174822-7174973 Length = 398 Score = 34.3 bits (75), Expect = 0.094 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTSTEW 512 D Y VLGV R ATD EIK A+R+ + ++ Sbjct: 25 DPYEVLGVGRNATDQEIKSAFRRMALKY 52 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 AL HPDKN D A+ FQE++ +Y +L Sbjct: 49 ALKYHPDKNGD-DPVASDMFQEVTFSYNIL 77 >05_04_0387 - 20834510-20834978,20836866-20837329,20837458-20837634 Length = 369 Score = 34.3 bits (75), Expect = 0.094 Identities = 16/27 (59%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = +1 Query: 514 HPDKNPDXS-DEANRRFQEISEAYEVL 591 HPDK+P S +EA RF+ I+EAYE L Sbjct: 35 HPDKHPPSSKNEAEARFKAITEAYEAL 61 Score = 29.9 bits (64), Expect = 2.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +3 Query: 432 YYRVLGVTRTATDTEIKKAYRKTSTEW 512 YYR+L ++R + EI+ AY+ +W Sbjct: 8 YYRILNISRDTSPKEIRAAYKTLVRQW 34 >12_01_0915 - 8908643-8908756,8909086-8909203,8909570-8909682, 8911138-8911218,8911307-8911357,8912173-8912232, 8913353-8913419,8913509-8913759 Length = 284 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVLQ 594 +L HPDKNPD E+ + F +I+ AYE+L+ Sbjct: 81 SLKHHPDKNPD--PESRKLFVKIANAYEILK 109 >12_01_0438 + 3455686-3455692,3456149-3456240,3457422-3457505, 3457598-3457636,3457952-3458041,3458567-3458611, 3458702-3458789,3458902-3458966,3459063-3459137, 3460231-3460303,3460708-3460799,3460896-3460967, 3461165-3461221,3461316-3461364,3461522-3461610 Length = 338 Score = 33.9 bits (74), Expect = 0.12 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +1 Query: 514 HPDKNPDXSDEANRRFQEISEAYEVLQ 594 HPD N + +D A ++FQE+ AYEVL+ Sbjct: 39 HPDTNKEDAD-AEKKFQEVQHAYEVLK 64 Score = 31.5 bits (68), Expect = 0.67 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAY 491 DYY VLGV + A+ ++IKKAY Sbjct: 11 DYYDVLGVNKDASASDIKKAY 31 >01_06_1526 + 38003071-38003247,38003338-38003690,38004489-38004987 Length = 342 Score = 33.5 bits (73), Expect = 0.16 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +1 Query: 514 HPDKNPDXSD-EANRRFQEISEAYEVL 591 HPDK+P S EA RF+ I+EAYE L Sbjct: 35 HPDKHPPSSKPEAEARFKAITEAYEAL 61 >02_04_0220 - 21014225-21014386,21014492-21014572,21014739-21014938, 21014999-21015157,21015248-21015377,21015520-21015673, 21015785-21015867,21015981-21016040,21016131-21016217 Length = 371 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +1 Query: 514 HPDKNPDXSDEANRRFQEISEAYEVL 591 HPDKNP+ +A +FQ + EAY+VL Sbjct: 34 HPDKNPN-DPQAAEKFQALGEAYQVL 58 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAY 491 ++Y VLGV A+D EI+KAY Sbjct: 6 EFYDVLGVCPAASDDEIRKAY 26 >02_01_0717 + 5351504-5351602,5353401-5353499,5353574-5353675, 5353756-5353815,5353900-5354006,5354114-5354196, 5354372-5354462,5354561-5354768 Length = 282 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +3 Query: 435 YRVLGVTRTATDTEIKKAYRK 497 Y +LGV RTA+ EIKKAY K Sbjct: 32 YEILGVERTASQQEIKKAYHK 52 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 AL HPDKNP +EA +FQ++ + +L Sbjct: 54 ALRLHPDKNP-GDEEAKEKFQQLQKVISIL 82 >01_05_0327 + 20984336-20985478 Length = 380 Score = 33.1 bits (72), Expect = 0.22 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTS 503 DYY++LG+ + T +++KAYRK S Sbjct: 130 DYYQILGLEKDCTVEDVRKAYRKLS 154 >02_05_0699 + 31013176-31013345,31013749-31013872,31013950-31014032, 31014106-31014217,31014297-31014401,31014809-31014859, 31015893-31015979,31016325-31016402,31016477-31016530, 31016608-31016892 Length = 382 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTSTEW 512 D Y VLGV R AT+ EIK A+R+ + ++ Sbjct: 31 DPYEVLGVGRNATEQEIKSAFRRMALKY 58 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 AL HPDKN D A+ +FQE + +Y +L Sbjct: 55 ALKYHPDKNAD-DPVASDKFQEATFSYNIL 83 >04_03_0735 + 19141038-19143227 Length = 729 Score = 31.9 bits (69), Expect = 0.50 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTSTE 509 D+YR+L +T A + E+KK YRK + + Sbjct: 62 DWYRILSLTAFADEEEVKKQYRKLALQ 88 >02_05_0381 - 28483425-28483458,28483588-28483658,28483746-28483819, 28483975-28484050,28484129-28484206,28485557-28485589 Length = 121 Score = 31.9 bits (69), Expect = 0.50 Identities = 16/30 (53%), Positives = 20/30 (66%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 AL HPDK+ +D +FQEI+EAY VL Sbjct: 36 ALMWHPDKHKGDND-VTAKFQEINEAYTVL 64 Score = 31.1 bits (67), Expect = 0.88 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTSTEW 512 DYY+VL V A+D IK +YR+ + W Sbjct: 12 DYYKVLEVDYDASDDTIKLSYRRLALMW 39 >01_01_0013 + 81507-81932,82718-82864 Length = 190 Score = 31.9 bits (69), Expect = 0.50 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +1 Query: 514 HPDKNP-DXSDEANRRFQEISEAYEVL 591 HPD +P D + E RRF E+ EAYE L Sbjct: 82 HPDVSPPDAAAENTRRFIEVQEAYETL 108 >02_03_0378 + 18327622-18329826 Length = 734 Score = 31.5 bits (68), Expect = 0.67 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTSTE 509 D+YR+L ++ +A + E+KK YRK + + Sbjct: 72 DWYRILSLSASADEEEVKKQYRKLALQ 98 >01_05_0090 + 18038219-18038421,18039365-18039488,18040229-18040311, 18040401-18040473,18040584-18040688,18040803-18040853, 18041705-18041781,18041879-18042037,18043548-18043692, 18043776-18043884,18043959-18044107,18044175-18044258, 18044784-18044825,18045811-18046014 Length = 535 Score = 31.5 bits (68), Expect = 0.67 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTSTEW 512 D Y VL V R ++D EIK AYRK + ++ Sbjct: 18 DPYEVLSVPRDSSDQEIKSAYRKLALKF 45 >12_02_0426 - 18959301-18959396,18959593-18959727,18959821-18959910, 18960760-18960821,18961186-18961510 Length = 235 Score = 31.1 bits (67), Expect = 0.88 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTSTE 509 D+Y LG+TR+A+ E+K AY K E Sbjct: 114 DHYGRLGITRSASTDEVKAAYEKKCEE 140 >06_03_0339 - 19687749-19690805 Length = 1018 Score = 31.1 bits (67), Expect = 0.88 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = +3 Query: 426 VDYYRVLGVTRTATDTEIKKAYRK 497 +D+Y +L V TA DT IKK YRK Sbjct: 66 IDWYGILQVPVTADDTLIKKQYRK 89 >06_01_0806 - 6048042-6048138,6048461-6048550,6049362-6049425, 6049504-6049552,6050403-6050459,6050953-6051024, 6051912-6052003,6052542-6052614,6052686-6052748, 6052837-6052901,6053803-6053890,6053974-6054015, 6054097-6054188,6054601-6054688,6055134-6055225, 6055368-6055419 Length = 391 Score = 31.1 bits (67), Expect = 0.88 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTSTEW 512 DYY++LGV + A+ EIK+A+ + + Sbjct: 26 DYYKILGVPKDASQEEIKRAFHSLAKRY 53 >05_06_0167 - 26104527-26104567,26105130-26105226,26105377-26105415, 26105628-26105678,26105978-26106059,26106222-26106282, 26106380-26106509,26106630-26106758,26107057-26107314 Length = 295 Score = 31.1 bits (67), Expect = 0.88 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +3 Query: 414 DTAMVDYYRVLGVTRTATDTEIKKAY 491 D D+Y VLGV AT EIKKAY Sbjct: 74 DEVADDFYSVLGVMPDATPEEIKKAY 99 >01_06_0592 + 30465956-30466210,30466401-30466529,30466631-30466760, 30466861-30466981,30467111-30467192,30467334-30467384, 30467836-30467929,30468046-30468173 Length = 329 Score = 31.1 bits (67), Expect = 0.88 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAY 491 DYY VLGV AT +IKKAY Sbjct: 78 DYYAVLGVMPDATPQQIKKAY 98 >01_05_0646 + 23907837-23907956,23908077-23908164,23908282-23908364, 23908487-23908543,23908694-23908939 Length = 197 Score = 31.1 bits (67), Expect = 0.88 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 3/33 (9%) Frame = +1 Query: 502 ALNGHPDKNPDX---SDEANRRFQEISEAYEVL 591 A+ HPDK ++EA RFQ++ EAY+VL Sbjct: 39 AMKWHPDKITSGRVDAEEAKSRFQQVHEAYQVL 71 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 432 YYRVLGVTRTATDTEIKKAYRKTSTEW 512 YY VLGV A+ EI+ AY + + +W Sbjct: 16 YYAVLGVHPGASAAEIRAAYHRLAMKW 42 >12_02_0454 + 19199063-19200757,19202201-19202287 Length = 593 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = +1 Query: 502 ALNGHPDKNPDXSD--EANRRFQEISEAYEVL 591 AL+ HPDK P SD A FQE+ A+ VL Sbjct: 34 ALSLHPDKQPPGSDVAAATAAFQELQHAHSVL 65 >08_02_0878 + 22152437-22152532,22152619-22152718,22152907-22152974, 22153085-22153141,22153243-22153350,22153888-22153971 Length = 170 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 435 YRVLGVTRTATDTEIKKAYRKTSTEW 512 Y VLGV +D +++ AYRK + +W Sbjct: 9 YAVLGVASDCSDADLRTAYRKLAMKW 34 >12_02_1140 + 26411424-26411998,26412491-26412761,26412848-26413405 Length = 467 Score = 30.3 bits (65), Expect = 1.5 Identities = 23/73 (31%), Positives = 35/73 (47%) Frame = +3 Query: 432 YYRVLGVTRTATDTEIKKAYRKTSTEWAS**KS*XF**S*SKIPRNF*SL*GSSDEXKRR 611 YY +LGV R A EI++AYR+ + + ++ R + L D R Sbjct: 13 YYDLLGVPRGADGDEIRRAYRRAAVTHHP--DKGGDEEAFKEVARAYQVL---GDPALRE 67 Query: 612 VYDQYGKEXLNNG 650 VYD YG++ +N G Sbjct: 68 VYDVYGEDGVNGG 80 >12_01_0724 - 6377023-6379392 Length = 789 Score = 30.3 bits (65), Expect = 1.5 Identities = 22/66 (33%), Positives = 28/66 (42%), Gaps = 1/66 (1%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVLQMRXNAECMTS-TARXG*ITEGSSLCRRRG 678 AL HP PD A R ++++ Q R A +S T G T GS RRR Sbjct: 87 ALLRHPPVVPDPETPARRWLDDVADLVMTAQQRLGAGGRSSATKASGAATAGSVSSRRRA 146 Query: 679 LRILAM 696 R A+ Sbjct: 147 RRAAAV 152 >07_03_1759 + 29285262-29287208 Length = 648 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +3 Query: 408 GRDTAMVDYYRVLGVTRTATDTEIKKAY 491 G + VDYY +LGV R T +E+++A+ Sbjct: 449 GGEACSVDYYALLGVRRGCTRSELERAH 476 >04_03_0283 + 13887388-13887573,13887711-13887806,13888517-13888637, 13888734-13888840,13888949-13889166,13890219-13890396, 13890492-13890611,13891601-13891687,13892401-13892511, 13892618-13893439 Length = 681 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/34 (32%), Positives = 24/34 (70%) Frame = +3 Query: 411 RDTAMVDYYRVLGVTRTATDTEIKKAYRKTSTEW 512 R+ + + Y +LG+ A++++IKK+YR+ S ++ Sbjct: 93 REVQVFEPYSILGLEPGASESDIKKSYRRLSIQY 126 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/27 (59%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = +1 Query: 514 HPDKNPDXSDEANRRFQE-ISEAYEVL 591 HPDKNPD EA++ F E IS+AY+ L Sbjct: 127 HPDKNPD--PEAHKYFVEFISKAYQAL 151 >03_02_0205 + 6389343-6389609,6390418-6390486,6390662-6390757, 6391120-6391244,6391331-6391483,6392863-6392992, 6393122-6393282,6393660-6393702,6393869-6394042, 6394471-6394525,6394567-6394746,6396234-6396339, 6396448-6396506,6397419-6397541,6397825-6397919 Length = 611 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 514 HPDKNPDXSDEANRRFQEISEAYEVL 591 HPD N D A +F+EIS AYE+L Sbjct: 91 HPDMNKDPG--AEEKFKEISAAYEIL 114 Score = 29.5 bits (63), Expect = 2.7 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTSTEW-AS**KS*XF**S*SKIPRNF*SL*GSSDEXK 605 DYY L + R AT E+K AYR + ++ K +I + L SDE K Sbjct: 63 DYYATLNLRRDATLQEVKTAYRTLARKYHPDMNKDPGAEEKFKEISAAYEIL---SDEEK 119 Query: 606 RRVYDQYGKEXL 641 R +YD++G+ L Sbjct: 120 RSLYDRFGEAGL 131 >03_02_0845 - 11700830-11701327 Length = 165 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 435 YRVLGVTRTATDTEIKKAYRKTSTEW 512 Y VL V TA EIK AYR+ + W Sbjct: 56 YEVLAVEETAGAEEIKAAYRRAARRW 81 >06_03_0032 - 15697530-15697669,15699215-15699437,15699823-15699929, 15700047-15700224,15700393-15700455,15700474-15700602, 15701211-15701430,15702162-15702262,15702954-15703062, 15705169-15705290,15705473-15705515,15705848-15705903, 15705983-15706089,15706167-15706342,15706507-15706618, 15706711-15706759,15707184-15707276,15707452-15707571, 15707686-15707787,15709442-15709540,15710103-15710237, 15710421-15710499,15710747-15710822,15710904-15710993, 15711139-15711217,15711304-15711338,15711457-15711531, 15712628-15713375 Length = 1221 Score = 29.5 bits (63), Expect = 2.7 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = +3 Query: 411 RDTAMVDYYRVLGVTRTATDTEIKKAYRK 497 R A DYY+VLGV TEIK+AYRK Sbjct: 971 RGKAREDYYQVLGV------TEIKEAYRK 993 >01_01_1211 + 9753518-9753894,9754265-9754313,9754747-9754773 Length = 150 Score = 29.5 bits (63), Expect = 2.7 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAY 491 DYYR LG+ R A+ E+K A+ Sbjct: 8 DYYRTLGIERGASKAEVKAAF 28 >10_08_1023 - 22341815-22342042,22342179-22342247,22342717-22342840, 22343193-22343317,22343815-22344276,22344357-22344700, 22345061-22345406,22345492-22345941,22346760-22347051, 22347171-22347515,22347611-22347834,22348072-22348563, 22348664-22349056,22349601-22349741,22349845-22350207, 22350494-22352683,22353298-22353360,22353434-22353535, 22353672-22354027,22354326-22354413,22354517-22354750, 22355508-22355975 Length = 2632 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVLQ 594 A+ HPDKNP E +F + +AYE LQ Sbjct: 1604 AIKYHPDKNP----EGREKFVAVQKAYERLQ 1630 >02_05_0971 - 33188816-33188965,33190406-33190705,33191500-33191562, 33191637-33191710,33191880-33191973,33193396-33193482, 33193753-33193887 Length = 300 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRK 497 D Y VLG+ + +D ++K AYRK Sbjct: 20 DLYAVLGLKKECSDADLKLAYRK 42 >06_02_0121 + 12080417-12081632,12082428-12082780,12082844-12083776 Length = 833 Score = 28.3 bits (60), Expect = 6.2 Identities = 21/66 (31%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVLQMRXNAECMTS-TARXG*ITEGSSLCRRRG 678 AL HP PD R +++ Q R A +S T G T GS RRR Sbjct: 87 ALLRHPPVIPDPETPTRRWLDDVANLVMTAQQRLGAGWRSSATKATGVATAGSVSSRRRA 146 Query: 679 LRILAM 696 R A+ Sbjct: 147 RRAAAV 152 >04_04_1571 + 34504087-34504421,34505002-34505731,34506091-34512077, 34512493-34513964,34514114-34514377,34514761-34514978, 34515759-34516030,34516190-34516559,34516578-34516797, 34516819-34518931,34518941-34519193,34519269-34519401, 34520597-34521114,34521207-34522115,34522195-34522368, 34522833-34522882,34523963-34524035,34524413-34524477, 34524736-34525522,34525622-34525878,34525989-34526109, 34526315-34526956 Length = 5320 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYR 494 D Y +LGV R++ +EIK AYR Sbjct: 4920 DLYGLLGVERSSPQSEIKAAYR 4941 >02_03_0273 + 17173983-17174339,17174423-17174575,17174638-17174700, 17174943-17175026,17175120-17175242,17175466-17175519, 17175669-17175764,17176163-17176258,17177179-17177324, 17178503-17178632,17178697-17179272,17179364-17179462, 17179535-17179687,17179794-17180558,17181384-17181683 Length = 1064 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +3 Query: 195 EKVSLIRSVNH*KCKCYYLLTSSVSLC 275 EK L+ + H K + +Y+L+SS++LC Sbjct: 745 EKEVLLEEIQHLKNQLHYMLSSSMALC 771 >01_01_1212 + 9763949-9764412,9765183-9765252,9765356-9765457 Length = 211 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRK 497 D+Y+ LG+ + AT E+K A+R+ Sbjct: 4 DHYQTLGLRQDATKAEVKAAFRR 26 >08_02_1491 + 27500532-27500972 Length = 146 Score = 27.9 bits (59), Expect = 8.2 Identities = 19/51 (37%), Positives = 23/51 (45%) Frame = +3 Query: 357 YFTGKARCYFKILEPP*GRDTAMVDYYRVLGVTRTATDTEIKKAYRKTSTE 509 Y K RC + P T Y VLG+ AT EIK AYR+ + E Sbjct: 24 YRARKVRCAVAVAPAPAPAGTL----YDVLGLRAGATVREIKAAYRRLARE 70 >04_04_0645 + 26913947-26915783,26915833-26916308,26916372-26917220 Length = 1053 Score = 27.9 bits (59), Expect = 8.2 Identities = 21/66 (31%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVLQMRXNAECMTS-TARXG*ITEGSSLCRRRG 678 AL HP PD R +++ Q R A +S T G T GS RRR Sbjct: 87 ALLRHPPVVPDPETPTRRWLDDVANLVMTAQQRLGAGGRSSATKATGVATAGSVSSRRRA 146 Query: 679 LRILAM 696 R A+ Sbjct: 147 RRAAAV 152 >03_06_0554 + 34691050-34691242,34691327-34691394,34691754-34692275 Length = 260 Score = 27.9 bits (59), Expect = 8.2 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +3 Query: 411 RDTAMVDYYRVLGVTRTATDTEIKKAYRKTSTE 509 R VD+Y VL V AT+ +++ YR+ + + Sbjct: 35 RSPPFVDWYLVLAVADAATEDAVRRRYRQLALQ 67 >03_03_0278 - 16126803-16129049 Length = 748 Score = 27.9 bits (59), Expect = 8.2 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRK 497 D+Y +L V +A D +KK YRK Sbjct: 66 DWYSILSVESSADDETLKKQYRK 88 >03_02_0727 - 10742899-10744375,10744470-10744933,10745412-10745477 Length = 668 Score = 27.9 bits (59), Expect = 8.2 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +3 Query: 426 VDYYRVLGVTRTATDTEIKKAY 491 +DYY +LGV R T +E+++A+ Sbjct: 420 IDYYALLGVRRGCTRSELERAH 441 >03_02_0330 + 7502593-7504956,7505020-7506312,7522011-7522235 Length = 1293 Score = 27.9 bits (59), Expect = 8.2 Identities = 21/66 (31%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVLQMRXNAECMTS-TARXG*ITEGSSLCRRRG 678 AL HP PD R +++ Q R A +S T G T GS RRR Sbjct: 87 ALLRHPPVVPDPETPTRRWLDDVANLVMTAQQRLGAGGRSSATKATGAATAGSVSSRRRA 146 Query: 679 LRILAM 696 R A+ Sbjct: 147 WRAAAV 152 >01_06_1164 - 35026345-35026954,35027853-35027939,35028120-35028493, 35037372-35038586,35038659-35039316,35039331-35041012 Length = 1541 Score = 27.9 bits (59), Expect = 8.2 Identities = 21/66 (31%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVLQMRXNAECMTS-TARXG*ITEGSSLCRRRG 678 AL HP PD R +++ Q R A +S T G T GS RRR Sbjct: 87 ALLRHPPVVPDQETPTRRWLDDVANLVMTAQQRLGAGGRSSATKATGAATAGSVSSRRRA 146 Query: 679 LRILAM 696 R A+ Sbjct: 147 RRAAAV 152 >01_01_1190 + 9463973-9465732,9466210-9466440,9467664-9467793, 9468723-9468888,9469528-9469859,9470284-9470513, 9471535-9471613,9471689-9471865 Length = 1034 Score = 27.9 bits (59), Expect = 8.2 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +3 Query: 426 VDYYRVLGVTRTATDTEIKKAYRKTS 503 ++ Y +LG+ + T +IKKAYRK + Sbjct: 944 LNVYLILGIEPSCTFLDIKKAYRKAA 969 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,553,230 Number of Sequences: 37544 Number of extensions: 243056 Number of successful extensions: 646 Number of sequences better than 10.0: 73 Number of HSP's better than 10.0 without gapping: 534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 638 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -