BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0470.Seq (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) 49 4e-06 SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) 49 4e-06 SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) 48 6e-06 SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) 46 2e-05 SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) 40 0.002 SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) 38 0.010 SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 36 0.032 SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) 36 0.032 SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 36 0.032 SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) 36 0.032 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 35 0.055 SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) 33 0.17 SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) 31 0.68 SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.68 SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) 30 2.1 SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) 29 4.8 SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) 28 6.3 SB_16773| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) Length = 138 Score = 48.8 bits (111), Expect = 4e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 AL HPDKNP +EA R+F+EISEAYEVL Sbjct: 27 ALKWHPDKNPQNKEEAERKFKEISEAYEVL 56 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/30 (50%), Positives = 23/30 (76%) Frame = +3 Query: 423 MVDYYRVLGVTRTATDTEIKKAYRKTSTEW 512 M DYY +L V R+A++ +IKK+YRK + +W Sbjct: 1 MADYYDILEVPRSASEQDIKKSYRKLALKW 30 >SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) Length = 250 Score = 48.8 bits (111), Expect = 4e-06 Identities = 27/73 (36%), Positives = 41/73 (56%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTSTEWAS**KS*XF**S*SKIPRNF*SL*GSSDEXKR 608 DYY VLGV R+A++ ++KKAYR+ + W + K + + SD+ KR Sbjct: 4 DYYEVLGVPRSASEEDVKKAYRRQALRWHPDKNPTNREHAEEKFKKLSEAYEVLSDKEKR 63 Query: 609 RVYDQYGKEXLNN 647 +YD+YGKE L + Sbjct: 64 DIYDKYGKEGLTS 76 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/52 (36%), Positives = 30/52 (57%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVLQMRXNAECMTSTARXG*ITEGS 657 AL HPDKNP + A +F+++SEAYEVL + + + G ++G+ Sbjct: 28 ALRWHPDKNPTNREHAEEKFKKLSEAYEVLSDKEKRDIYDKYGKEGLTSQGT 79 >SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 576 Score = 48.4 bits (110), Expect = 6e-06 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 2/76 (2%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTSTEW-AS**KS*XF**S*SKIPRNF*SL*GSSDEXK 605 DYY++LGV R A+D +IKKA+RK + ++ K ++ + L SDE K Sbjct: 26 DYYQILGVPRNASDKQIKKAFRKMAVKYHPDKNKGKDAEEKFREVAEAYEVL---SDENK 82 Query: 606 RRVYDQYGKEXL-NNG 650 RR YDQ+G+E L NNG Sbjct: 83 RRQYDQFGEEGLKNNG 98 Score = 33.1 bits (72), Expect = 0.22 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 A+ HPDKN +A +F+E++EAYEVL Sbjct: 50 AVKYHPDKNK--GKDAEEKFREVAEAYEVL 77 >SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) Length = 399 Score = 46.4 bits (105), Expect = 2e-05 Identities = 28/75 (37%), Positives = 43/75 (57%) Frame = +3 Query: 426 VDYYRVLGVTRTATDTEIKKAYRKTSTEWAS**KS*XF**S*SKIPRNF*SL*GSSDEXK 605 +DYY +LG+TR+ATD +IKK YRK S ++ + K + + SD K Sbjct: 3 LDYYDILGLTRSATDADIKKEYRKLSLKYHPDKNQEPS--AEVKFRQAAEAYDVLSDPKK 60 Query: 606 RRVYDQYGKEXLNNG 650 R +Y+Q+G+E L +G Sbjct: 61 RAIYNQFGEEGLKSG 75 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 +L HPDKN + S E +F++ +EAY+VL Sbjct: 28 SLKYHPDKNQEPSAEV--KFRQAAEAYDVL 55 >SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 41.5 bits (93), Expect = 6e-04 Identities = 27/75 (36%), Positives = 41/75 (54%), Gaps = 1/75 (1%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTSTEW-AS**KS*XF**S*SKIPRNF*SL*GSSDEXK 605 +YY +LGV + A+D E+KKAY+K + ++ K +I + L SD K Sbjct: 4 NYYDILGVKKDASDQELKKAYKKQAFKYHPDKNKDPGAEEKFKEIAEAYEVL---SDPQK 60 Query: 606 RRVYDQYGKEXLNNG 650 R ++DQYG+E L G Sbjct: 61 REIFDQYGEEGLKGG 75 Score = 34.7 bits (76), Expect = 0.073 Identities = 17/30 (56%), Positives = 20/30 (66%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 A HPDKN D A +F+EI+EAYEVL Sbjct: 28 AFKYHPDKNKDPG--AEEKFKEIAEAYEVL 55 >SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/30 (56%), Positives = 23/30 (76%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 AL HPDKN D ++E+ R F+EI +AY+VL Sbjct: 28 ALKWHPDKNLDNAEESTRVFREIQQAYDVL 57 Score = 34.3 bits (75), Expect = 0.096 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +3 Query: 432 YYRVLGVTRTATDTEIKKAYRKTSTEW 512 +Y VLGV R D+ +KK YRK + +W Sbjct: 5 HYEVLGVERDVDDSALKKTYRKLALKW 31 >SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 966 Score = 39.9 bits (89), Expect = 0.002 Identities = 27/73 (36%), Positives = 42/73 (57%) Frame = +3 Query: 432 YYRVLGVTRTATDTEIKKAYRKTSTEWAS**KS*XF**S*SKIPRNF*SL*GSSDEXKRR 611 YY +L V TAT TEIKK+YRK + ++ K+ +I + + L SDE KR+ Sbjct: 66 YYDILNVPPTATATEIKKSYRKLALKYHP-DKNPDEGDRFKQISQAYEVL---SDEKKRK 121 Query: 612 VYDQYGKEXLNNG 650 +YD+ G++ + G Sbjct: 122 IYDEGGEDAIKGG 134 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/30 (63%), Positives = 22/30 (73%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 AL HPDKNPD D RF++IS+AYEVL Sbjct: 89 ALKYHPDKNPDEGD----RFKQISQAYEVL 114 >SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) Length = 351 Score = 39.9 bits (89), Expect = 0.002 Identities = 28/72 (38%), Positives = 39/72 (54%), Gaps = 1/72 (1%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTSTEW-AS**KS*XF**S*SKIPRNF*SL*GSSDEXK 605 DYY VL V + A+ +IKKAYRK + ++ KS +I + L SD K Sbjct: 4 DYYAVLNVDKAASADDIKKAYRKQALKYHPDKNKSPGAEEKFKEISEAYEVL---SDPKK 60 Query: 606 RRVYDQYGKEXL 641 + +YDQYG+E L Sbjct: 61 KEIYDQYGEEGL 72 Score = 35.9 bits (79), Expect = 0.032 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 AL HPDKN S A +F+EISEAYEVL Sbjct: 28 ALKYHPDKNK--SPGAEEKFKEISEAYEVL 55 >SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 875 Score = 39.1 bits (87), Expect = 0.003 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 A+ HPD++ D +EA + F EI EAYE+L Sbjct: 818 AMKWHPDRHRDNKEEAQKHFMEIQEAYEIL 847 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +3 Query: 435 YRVLGVTRTATDTEIKKAYRKTSTEW 512 YRVLG+T AT EIKK Y+K + +W Sbjct: 796 YRVLGLTEDATQEEIKKRYKKLAMKW 821 >SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1353 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/39 (43%), Positives = 23/39 (58%) Frame = +3 Query: 381 YFKILEPP*GRDTAMVDYYRVLGVTRTATDTEIKKAYRK 497 YFK+ + P VDYY VL V + A + E+K AYR+ Sbjct: 115 YFKMADAPHDESEDEVDYYAVLAVRKEANEDELKAAYRR 153 >SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 37.9 bits (84), Expect = 0.008 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTSTEW 512 DYY++LG+ R EI KAYRK + +W Sbjct: 208 DYYKILGLKRNCNKREITKAYRKLAVKW 235 >SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 37.5 bits (83), Expect = 0.010 Identities = 13/23 (56%), Positives = 21/23 (91%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRK 497 DYY++L +++TA++ EIKKAY+K Sbjct: 159 DYYKILNISKTASEDEIKKAYKK 181 Score = 32.7 bits (71), Expect = 0.29 Identities = 15/34 (44%), Positives = 23/34 (67%), Gaps = 4/34 (11%) Frame = +1 Query: 502 ALNGHPDKNPDXSDE----ANRRFQEISEAYEVL 591 AL HPD++ SDE A ++F+E++EAY +L Sbjct: 183 ALKHHPDRHSGASDEQKKIAEKQFKEVNEAYSIL 216 >SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) Length = 264 Score = 37.5 bits (83), Expect = 0.010 Identities = 13/23 (56%), Positives = 21/23 (91%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRK 497 DYY++L +++TA++ EIKKAY+K Sbjct: 159 DYYKILNISKTASEDEIKKAYKK 181 Score = 32.7 bits (71), Expect = 0.29 Identities = 15/34 (44%), Positives = 23/34 (67%), Gaps = 4/34 (11%) Frame = +1 Query: 502 ALNGHPDKNPDXSDE----ANRRFQEISEAYEVL 591 AL HPD++ SDE A ++F+E++EAY +L Sbjct: 183 ALKHHPDRHSGASDEQKKIAEKQFKEVNEAYSIL 216 >SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1084 Score = 36.3 bits (80), Expect = 0.024 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = +1 Query: 514 HPDKNPDXSDEANRRFQEISEAYEVL 591 HPD N D S A+ +FQE+SEAYEVL Sbjct: 87 HPDTNKDKS--ASEKFQEVSEAYEVL 110 Score = 31.9 bits (69), Expect = 0.51 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAY 491 DYY++LGV A EIKKAY Sbjct: 59 DYYKILGVPPNANQKEIKKAY 79 >SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 36.3 bits (80), Expect = 0.024 Identities = 15/25 (60%), Positives = 22/25 (88%) Frame = +3 Query: 435 YRVLGVTRTATDTEIKKAYRKTSTE 509 Y VLGV++TA+++EIK+AYRK S + Sbjct: 17 YDVLGVSKTASESEIKRAYRKISLQ 41 >SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 386 Score = 35.9 bits (79), Expect = 0.032 Identities = 27/72 (37%), Positives = 38/72 (52%) Frame = +3 Query: 435 YRVLGVTRTATDTEIKKAYRKTSTEWAS**KS*XF**S*SKIPRNF*SL*GSSDEXKRRV 614 Y +LGV + A+D +IKKAYRK + E K+ I + L SD KR + Sbjct: 7 YDLLGVPQNASDNDIKKAYRKLAKELHP-DKNPDTGEKFKDITFAYEIL---SDPEKREL 62 Query: 615 YDQYGKEXLNNG 650 YD+YG++ L G Sbjct: 63 YDRYGEKGLREG 74 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +1 Query: 514 HPDKNPDXSDEANRRFQEISEAYEVL 591 HPDKNPD + +F++I+ AYE+L Sbjct: 33 HPDKNPDTGE----KFKDITFAYEIL 54 >SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) Length = 161 Score = 35.9 bits (79), Expect = 0.032 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRK 497 +YY +LGV R A+D +IKKAYR+ Sbjct: 4 NYYAILGVPRNASDDDIKKAYRR 26 Score = 32.7 bits (71), Expect = 0.29 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 AL HPDKN + A +F+EISEAY+VL Sbjct: 28 ALIFHPDKNKNSG--AEEKFKEISEAYKVL 55 >SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 79 Score = 35.9 bits (79), Expect = 0.032 Identities = 27/72 (37%), Positives = 38/72 (52%) Frame = +3 Query: 435 YRVLGVTRTATDTEIKKAYRKTSTEWAS**KS*XF**S*SKIPRNF*SL*GSSDEXKRRV 614 Y +LGV + A+D +IKKAYRK + E K+ I + L SD KR + Sbjct: 7 YDLLGVPQNASDNDIKKAYRKLAKELHP-DKNPDTGEKFKDITFAYEIL---SDPEKREL 62 Query: 615 YDQYGKEXLNNG 650 YD+YG++ L G Sbjct: 63 YDRYGEKGLREG 74 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +1 Query: 514 HPDKNPDXSDEANRRFQEISEAYEVL 591 HPDKNPD + +F++I+ AYE+L Sbjct: 33 HPDKNPDTGE----KFKDITFAYEIL 54 >SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) Length = 238 Score = 35.9 bits (79), Expect = 0.032 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 4/77 (5%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTSTEWAS**KS*XF**S*SKIPRNF*SL*GS----SD 596 D+Y +LGV R A+ +IK+AYRK + + K F + + +D Sbjct: 25 DFYAILGVPRDASKNQIKRAYRKLAMKLHPDKNK-----DDPKAQEKFHDIGAAYEVLAD 79 Query: 597 EXKRRVYDQYGKEXLNN 647 + +R++YDQ G+E L N Sbjct: 80 DDQRKIYDQRGEEGLKN 96 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 35.1 bits (77), Expect = 0.055 Identities = 14/27 (51%), Positives = 21/27 (77%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTSTE 509 ++Y+VLGV TAT EI++AYR+ S + Sbjct: 2483 NFYQVLGVETTATQAEIRRAYRRISLQ 2509 >SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTSTEW 512 +YY VLGV R AT +I++AYR+ + ++ Sbjct: 4 NYYEVLGVERNATTDDIRRAYRRLALKY 31 Score = 31.1 bits (67), Expect = 0.90 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 AL HPDKN + F+E+SEAYEVL Sbjct: 28 ALKYHPDKNAGTEEN----FKEVSEAYEVL 53 >SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 711 Score = 33.5 bits (73), Expect = 0.17 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRK 497 DYY + G++R AT EI+KA++K Sbjct: 28 DYYELFGISRDATSKEIRKAFKK 50 >SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) Length = 291 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/30 (53%), Positives = 22/30 (73%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVL 591 AL HPDKNPD + +A+ F ++S+A EVL Sbjct: 31 ALKCHPDKNPD-NPKASELFHKLSKALEVL 59 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRK 497 +YY LGV + +T+ EI KAYRK Sbjct: 7 NYYDTLGVHKDSTEKEILKAYRK 29 >SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) Length = 238 Score = 31.5 bits (68), Expect = 0.68 Identities = 22/52 (42%), Positives = 29/52 (55%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVLQMRXNAECMTSTARXG*ITEGS 657 ++ HPD++ SD+ + FQEI+EAY VL N E R G I EGS Sbjct: 96 SMKHHPDRH-QGSDKKHEVFQEIAEAYSVL---GNLESRKQYDR-GLIVEGS 142 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTS 503 +YY VLGV+ A+ ++IK AY K S Sbjct: 72 NYYNVLGVSPKASQSKIKDAYYKLS 96 >SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 31.5 bits (68), Expect = 0.68 Identities = 22/52 (42%), Positives = 29/52 (55%) Frame = +1 Query: 502 ALNGHPDKNPDXSDEANRRFQEISEAYEVLQMRXNAECMTSTARXG*ITEGS 657 ++ HPD++ SD+ + FQEI+EAY VL N E R G I EGS Sbjct: 96 SMKHHPDRH-QGSDKKHEVFQEIAEAYSVL---GNLESRKQYDR-GLIVEGS 142 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRKTS 503 +YY VLGV+ A+ ++IK AY K S Sbjct: 72 NYYNVLGVSPKASQSKIKDAYYKLS 96 >SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 514 HPDKNPDXSDEANRRFQEISEAYEVL 591 HPD NPD D +++ F ++SEAY L Sbjct: 36 HPDVNPDDPD-SHKAFIKVSEAYTTL 60 >SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) Length = 211 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 514 HPDKNPDXSDEANRRFQEISEAYEVL 591 HPD NPD D +++ F ++SEAY L Sbjct: 97 HPDVNPDDPD-SHKAFIKVSEAYTTL 121 >SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) Length = 831 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +3 Query: 429 DYYRVLGVTRTATDTEIKKAYRK 497 D Y +LGV A+D +IK+ YRK Sbjct: 800 DPYSILGVPPEASDDDIKRQYRK 822 >SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) Length = 141 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +3 Query: 411 RDTAMVDYYRVLGVTRTATDTEIKKAYRKTSTE 509 R + D VLGV T T IK+AYRK +E Sbjct: 69 RGPTLEDACNVLGVKPTDDATTIKRAYRKLMSE 101 >SB_16773| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1644 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 505 LNGHPDKNPDXSDEANRRFQEISEAYEVLQM 597 L HPDKNPD + + FQ + + L++ Sbjct: 1398 LKWHPDKNPDDVEFCTKVFQHLQNEIQRLEI 1428 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,378,729 Number of Sequences: 59808 Number of extensions: 296580 Number of successful extensions: 545 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 539 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -