BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0470.Seq (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 23 3.7 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 3.7 S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor prot... 22 6.4 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +1 Query: 556 RFQEISEAYEVLQ 594 RF+E+SE Y +LQ Sbjct: 60 RFEEVSEKYGILQ 72 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.6 bits (46), Expect = 3.7 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -2 Query: 343 P*NHNGKYDFRICEHRLV 290 P +GK+D+R+ H+L+ Sbjct: 174 PQRTDGKHDYRVWNHQLI 191 >S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor protein. Length = 169 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +2 Query: 278 SHATNQTVFTNPKIVFSIVVSRLTPVVFYRKSPML 382 S+ T ++ +P FS+ ++++ V + PML Sbjct: 130 SYGTLFFIYVHPSATFSLDLNKVVSVFYTAVIPML 164 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,344 Number of Sequences: 438 Number of extensions: 2651 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -