BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0466.Seq (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPJ698.03c |prp12|sap130|U2 snRNP-associated protein Sap130 |S... 30 0.28 SPCC74.04 |||amino acid permease, unknown 15|Schizosaccharomyces... 28 1.1 SPAC17A2.01 |bsu1|SPAC1B1.05, bsu1|high-affinity import carrier ... 27 2.0 SPBC3D6.07 |gpi3||pig-A|Schizosaccharomyces pombe|chr 2|||Manual 25 7.9 >SPAPJ698.03c |prp12|sap130|U2 snRNP-associated protein Sap130 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1206 Score = 30.3 bits (65), Expect = 0.28 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 601 YSNSGFAASWASRHCPEGILILGKN 675 YS A+S+AS CPEGI+ + KN Sbjct: 754 YSAIDHASSFASEQCPEGIVAIQKN 778 >SPCC74.04 |||amino acid permease, unknown 15|Schizosaccharomyces pombe|chr 3|||Manual Length = 557 Score = 28.3 bits (60), Expect = 1.1 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -3 Query: 204 VQYQFVEVINKTLKSDLNTKLELFTMYVFNLFFYLSLVVILIM 76 + QF+ I ++ + KL Y+ LF ++S++VIL M Sbjct: 192 IAIQFIHFILASMPTKYIAKLNSVGTYLNTLFLFISMIVILAM 234 >SPAC17A2.01 |bsu1|SPAC1B1.05, bsu1|high-affinity import carrier for pyridoxine, pyridoxal, and pyridoxamine Bsu1|Schizosaccharomyces pombe|chr 1|||Manual Length = 526 Score = 27.5 bits (58), Expect = 2.0 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 455 FPWTSPIGWHSMPKKGSGNSW 517 FPW SPI +SM +G++W Sbjct: 412 FPWMSPIVGNSMVTVANGHNW 432 >SPBC3D6.07 |gpi3||pig-A|Schizosaccharomyces pombe|chr 2|||Manual Length = 456 Score = 25.4 bits (53), Expect = 7.9 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +3 Query: 492 PKKVRVIPGPILYENFKKKKPPSNRGK-IITVV 587 PK+V VIP ++ ENF + PS K +T+V Sbjct: 164 PKRVSVIPNALVAENF--QPDPSKASKDFLTIV 194 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,842,837 Number of Sequences: 5004 Number of extensions: 62196 Number of successful extensions: 122 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -