BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0466.Seq (698 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC005094-1|AAH05094.1| 394|Homo sapiens transmembrane protein 7... 31 5.2 AL589685-4|CAI14162.1| 394|Homo sapiens novel protein protein. 31 5.2 >BC005094-1|AAH05094.1| 394|Homo sapiens transmembrane protein 79 protein. Length = 394 Score = 30.7 bits (66), Expect = 5.2 Identities = 15/43 (34%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Frame = -2 Query: 604 NTFIPRTTVIILPLLEGGFFFLKFSYKMGPGITRTF--FGHGM 482 +T++P+ T+ +LPLL G F + Y + + R+F FG+G+ Sbjct: 302 STYLPQDTLKLLPLLTGLFAVSRLIYWLTFAVGRSFRGFGYGL 344 >AL589685-4|CAI14162.1| 394|Homo sapiens novel protein protein. Length = 394 Score = 30.7 bits (66), Expect = 5.2 Identities = 15/43 (34%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Frame = -2 Query: 604 NTFIPRTTVIILPLLEGGFFFLKFSYKMGPGITRTF--FGHGM 482 +T++P+ T+ +LPLL G F + Y + + R+F FG+G+ Sbjct: 302 STYLPQDTLKLLPLLTGLFAVSRLIYWLTFAVGRSFRGFGYGL 344 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,771,196 Number of Sequences: 237096 Number of extensions: 2293882 Number of successful extensions: 9465 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9465 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8063224416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -