Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesV0461.Seq
         (795 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ869053-1|ABJ09600.1|  459|Apis mellifera capa-like receptor pr...    23   2.5  
DQ325067-1|ABD14081.1|  152|Apis mellifera complementary sex det...    22   7.5  
DQ325066-1|ABD14080.1|  152|Apis mellifera complementary sex det...    22   7.5  
DQ325065-1|ABD14079.1|  152|Apis mellifera complementary sex det...    22   7.5  
DQ325064-1|ABD14078.1|  152|Apis mellifera complementary sex det...    22   7.5  
DQ325063-1|ABD14077.1|  152|Apis mellifera complementary sex det...    22   7.5  
DQ325062-1|ABD14076.1|  152|Apis mellifera complementary sex det...    22   7.5  
DQ325061-1|ABD14075.1|  152|Apis mellifera complementary sex det...    22   7.5  
AY569719-1|AAS86672.1|  401|Apis mellifera feminizer protein.          22   7.5  
AY569718-1|AAS86671.1|  401|Apis mellifera feminizer protein.          22   7.5  
AY569715-1|AAS86668.1|  401|Apis mellifera feminizer protein.          22   7.5  
AY569714-1|AAS86667.1|  401|Apis mellifera feminizer protein.          22   7.5  
AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.          22   7.5  
AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.          22   7.5  
AY569702-1|AAS86655.1|  400|Apis mellifera feminizer protein.          22   7.5  
AY352276-1|AAQ67417.1|  385|Apis mellifera complementary sex det...    22   7.5  
AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex det...    22   7.5  
AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.     22   7.5  

>DQ869053-1|ABJ09600.1|  459|Apis mellifera capa-like receptor
           protein.
          Length = 459

 Score = 23.4 bits (48), Expect = 2.5
 Identities = 11/39 (28%), Positives = 19/39 (48%)
 Frame = -2

Query: 632 WLICYHWFHFHFILYYFAFQQHLELYAHFYFITLHYYYF 516
           + IC+  FH   +LY +    + ++    Y +T   YYF
Sbjct: 269 FFICWAPFHVQRLLYVYEDSTYDDINQWVYPLTGCLYYF 307


>DQ325067-1|ABD14081.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 729 RLIGNLMPFPPGF 767
           R IG L PFPP F
Sbjct: 120 RHIGPLTPFPPRF 132


>DQ325066-1|ABD14080.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 729 RLIGNLMPFPPGF 767
           R IG L PFPP F
Sbjct: 120 RHIGPLTPFPPRF 132


>DQ325065-1|ABD14079.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 729 RLIGNLMPFPPGF 767
           R IG L PFPP F
Sbjct: 120 RHIGPLTPFPPRF 132


>DQ325064-1|ABD14078.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 729 RLIGNLMPFPPGF 767
           R IG L PFPP F
Sbjct: 120 RHIGPLTPFPPRF 132


>DQ325063-1|ABD14077.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 729 RLIGNLMPFPPGF 767
           R IG L PFPP F
Sbjct: 120 RHIGPLTPFPPRF 132


>DQ325062-1|ABD14076.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 729 RLIGNLMPFPPGF 767
           R IG L PFPP F
Sbjct: 120 RHIGPLTPFPPRF 132


>DQ325061-1|ABD14075.1|  152|Apis mellifera complementary sex
           determiner protein.
          Length = 152

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 729 RLIGNLMPFPPGF 767
           R IG L PFPP F
Sbjct: 120 RHIGPLTPFPPRF 132


>AY569719-1|AAS86672.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 729 RLIGNLMPFPPGF 767
           R IG L PFPP F
Sbjct: 369 RHIGPLTPFPPRF 381


>AY569718-1|AAS86671.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 729 RLIGNLMPFPPGF 767
           R IG L PFPP F
Sbjct: 369 RHIGPLTPFPPRF 381


>AY569715-1|AAS86668.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 729 RLIGNLMPFPPGF 767
           R IG L PFPP F
Sbjct: 369 RHIGPLTPFPPRF 381


>AY569714-1|AAS86667.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 729 RLIGNLMPFPPGF 767
           R IG L PFPP F
Sbjct: 369 RHIGPLTPFPPRF 381


>AY569713-1|AAS86666.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 729 RLIGNLMPFPPGF 767
           R IG L PFPP F
Sbjct: 369 RHIGPLTPFPPRF 381


>AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 729 RLIGNLMPFPPGF 767
           R IG L PFPP F
Sbjct: 369 RHIGPLTPFPPRF 381


>AY569702-1|AAS86655.1|  400|Apis mellifera feminizer protein.
          Length = 400

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 729 RLIGNLMPFPPGF 767
           R IG L PFPP F
Sbjct: 368 RHIGPLTPFPPRF 380


>AY352276-1|AAQ67417.1|  385|Apis mellifera complementary sex
           determiner protein.
          Length = 385

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 729 RLIGNLMPFPPGF 767
           R IG L PFPP F
Sbjct: 353 RHIGPLTPFPPRF 365


>AY350616-1|AAQ57658.1|  401|Apis mellifera complementary sex
           determiner protein.
          Length = 401

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 9/13 (69%), Positives = 9/13 (69%)
 Frame = +3

Query: 729 RLIGNLMPFPPGF 767
           R IG L PFPP F
Sbjct: 369 RHIGPLTPFPPRF 381


>AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.
          Length = 388

 Score = 21.8 bits (44), Expect = 7.5
 Identities = 9/27 (33%), Positives = 17/27 (62%)
 Frame = +3

Query: 249 ETFVKIFLSNQYVMNLMKIKPFKTENY 329
           E FV++ +S++ +    KI+ F  E+Y
Sbjct: 65  EDFVRLLMSSEELRLFDKIRVFLDEDY 91


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 185,998
Number of Sequences: 438
Number of extensions: 3586
Number of successful extensions: 20
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 25125039
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)