BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0460.Seq (797 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 22 7.6 AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. 22 7.6 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 21.8 bits (44), Expect = 7.6 Identities = 8/30 (26%), Positives = 17/30 (56%) Frame = +2 Query: 491 RKNRSCKENDDDSITEEMPEPRTSDDPKGS 580 +K ++ ++ DD + + P ++ D KGS Sbjct: 212 KKKKNKEDEDDGATPRKAPPQLSTTDKKGS 241 >AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. Length = 148 Score = 21.8 bits (44), Expect = 7.6 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = +1 Query: 595 RRRSGRAAAHESRASRVFTSCTSAVLLAGARY 690 R+R+G + E++ +++ +A LLA + Y Sbjct: 96 RKRAGASGRREAKITKMVALMITAFLLAWSPY 127 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 227,919 Number of Sequences: 438 Number of extensions: 5042 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25246416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -