BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0459.Seq (797 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66060.1 68418.m08323 oxidoreductase, 2OG-Fe(II) oxygenase fa... 29 2.7 At1g20270.1 68414.m02531 oxidoreductase, 2OG-Fe(II) oxygenase fa... 29 3.6 At5g16220.1 68418.m01895 octicosapeptide/Phox/Bem1p (PB1) domain... 29 4.7 At3g57170.1 68416.m06365 N-acetylglucosaminyl transferase compon... 28 6.2 At4g26830.1 68417.m03863 glycosyl hydrolase family 17 protein si... 28 8.3 At3g12500.1 68416.m01556 basic endochitinase identical to basic ... 28 8.3 >At5g66060.1 68418.m08323 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to prolyl 4-hydroxylase, alpha subunit, from Rattus norvegicus [GI:474940], Mus musculus [SP|Q60715], Homo sapiens [GI:18073925]; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 267 Score = 29.5 bits (63), Expect = 2.7 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +3 Query: 276 HRRLQRARCTYLIVAARPLPIPATYRNKKTKSITLSNQRTRSSAPLKR 419 H L + C YLI A+P +T ++KT T S RT S L R Sbjct: 91 HNFLTKEECKYLIELAKPHMEKSTVVDEKTGKSTDSRVRTSSGTFLAR 138 >At1g20270.1 68414.m02531 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to prolyl 4-hydroxylase, alpha subunit, from Gallus gallus [GI:212530], Rattus norvegicus [GI:474940], Mus musculus [SP|Q60715]; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 287 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +3 Query: 276 HRRLQRARCTYLIVAARPLPIPATYRNKKTKSITLSNQRTRSSAPLKR 419 H L + C YLI A+P + +T + +T S RT S L+R Sbjct: 89 HNFLSKEECEYLISLAKPHMVKSTVVDSETGKSKDSRVRTSSGTFLRR 136 >At5g16220.1 68418.m01895 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein hypothetical proteins - Arabidopsis thaliana contains Pfam profile PF00564: PB1 domain Length = 476 Score = 28.7 bits (61), Expect = 4.7 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +2 Query: 263 QPEAAQAPSTGQVYIPDRRRQTLADTSYVPQQENEVYYPQQPE-NPIF 403 Q + Q TGQ YI TL T+Y N VYY + P+ PI+ Sbjct: 326 QQQHIQVIYTGQPYITGNSPMTLPATAY--HHTNHVYYQRPPQPYPIY 371 >At3g57170.1 68416.m06365 N-acetylglucosaminyl transferase component family protein / Gpi1 family protein similar to SP|O14357 N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein gpi1 {Schizosaccharomyces pombe}; contains Pfam profile PF05024: N-acetylglucosaminyl transferase component (Gpi1) Length = 560 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +3 Query: 369 SITLSNQRTRSSAPLKRPNWLTPL 440 S++ SN ++ APLK+P W+ L Sbjct: 49 SLSFSNSSPQTKAPLKKPKWVDDL 72 >At4g26830.1 68417.m03863 glycosyl hydrolase family 17 protein similar to elicitor inducible chitinase Nt-SubE76 GI:11071974 from [Nicotiana tabacum] Length = 448 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = +3 Query: 57 IMKVMYAFVMMSCA-LLVQAYPYNPYYGNVD--SLSYGSGDSNRGGL 188 ++K M A + + + L+V AYP+ Y N D SL Y N G + Sbjct: 179 VVKPMLALLQQTSSYLMVNAYPFFAYAANADKISLDYALFKENAGNI 225 >At3g12500.1 68416.m01556 basic endochitinase identical to basic endochitinase precursor SP:P19171 from [Arabidopsis thaliana] Length = 322 Score = 27.9 bits (59), Expect = 8.3 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = -3 Query: 342 LVSARVWRRRSGMYTWPVEGACAASGWRYRTRPYHRPHLWGCSKDCSNGS*P 187 L SA R++G P C+ GW T PY + GC C+ G P Sbjct: 17 LSSAEQCGRQAGGALCPNGLCCSEFGWCGNTEPYCKQP--GCQSQCTPGGTP 66 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,574,309 Number of Sequences: 28952 Number of extensions: 329079 Number of successful extensions: 1035 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 988 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1035 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1804564000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -