BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0458.Seq (347 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9634| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 2.4 SB_39064| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.7 >SB_9634| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 587 Score = 27.9 bits (59), Expect = 2.4 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +1 Query: 49 RKSHNHRVQATTHVCTALCPISHKCAERTHSAER 150 RK H ++TH T +C K + +H ER Sbjct: 145 RKRHRKETSSSTHSITYMCTTCEKVFKSSHQLER 178 >SB_39064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 25.8 bits (54), Expect = 9.7 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 252 LLVLCFCKRFVICIPDYSIDMKI 184 L+V C C VIC P S D ++ Sbjct: 8 LVVFCACVTIVICAPPISKDQRL 30 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,198,179 Number of Sequences: 59808 Number of extensions: 227335 Number of successful extensions: 682 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 681 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 523129866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -