BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0454.Seq (792 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 23 2.1 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 23 2.1 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 23 2.1 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 8.5 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 8.5 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 23.4 bits (48), Expect = 2.1 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +1 Query: 151 MLTELEKLPGVQL--GDFLLQFELDEPRESVREIARRNFEKYQ 273 +LTELEK P V++ L+ ++ R SV + +Q Sbjct: 117 LLTELEKYPNVKIYFNHKLMSVSFEDERISVMNLITEEITTHQ 159 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 23.4 bits (48), Expect = 2.1 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +1 Query: 151 MLTELEKLPGVQL--GDFLLQFELDEPRESVREIARRNFEKYQ 273 +LTELEK P V++ L+ ++ R SV + +Q Sbjct: 117 LLTELEKYPNVKIYFNHKLMSVSFEDERISVMNLITEEITTHQ 159 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 23.4 bits (48), Expect = 2.1 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +1 Query: 151 MLTELEKLPGVQL--GDFLLQFELDEPRESVREIARRNFEKYQ 273 +LTELEK P V++ L+ ++ R SV + +Q Sbjct: 117 LLTELEKYPNVKIYFNHKLMSVSFEDERISVMNLITEEITTHQ 159 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = -3 Query: 688 SNVKRXTEQVXXNXADSGXQHGRLQGNNTQ 599 SNV+ E+ +DS + + +GN+ Q Sbjct: 445 SNVEVVQEEAKKEESDSNNNNNKEEGNSCQ 474 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.4 bits (43), Expect = 8.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -2 Query: 593 ENLVPANIN*APISFQSPRRAPS 525 E V A+ P+SF SPRR S Sbjct: 216 ETPVLASYKSVPMSFSSPRRRHS 238 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,513 Number of Sequences: 336 Number of extensions: 3363 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21480183 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -