BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0454.Seq (792 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22A12.13 |mug84||pig-P |Schizosaccharomyces pombe|chr 1|||Ma... 27 4.1 >SPAC22A12.13 |mug84||pig-P |Schizosaccharomyces pombe|chr 1|||Manual Length = 120 Score = 26.6 bits (56), Expect = 4.1 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 6/37 (16%) Frame = -1 Query: 141 YLAGW---GIVTYKIVLVLYLHSMTNKY---VISFPF 49 YL+ W I T+ VLV+Y+H + N Y V++ PF Sbjct: 44 YLSRWWALAIPTWLFVLVIYIHVVLNAYNTEVLTKPF 80 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,976,527 Number of Sequences: 5004 Number of extensions: 54482 Number of successful extensions: 127 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 385381248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -