BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0453.Seq (835 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 59 6e-11 M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-... 24 2.0 M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-... 23 4.6 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 22 8.0 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 58.8 bits (136), Expect = 6e-11 Identities = 33/66 (50%), Positives = 38/66 (57%) Frame = +3 Query: 522 KVRSATFAAAFPSACGKTNLAMMTQHCPGYK*SAWGDDIAWIEVRQGRRTPGH*PRKTGP 701 K + AAFPSACGKTNLAMM PGYK GDDIAW++ + R P + G Sbjct: 8 KGKKRYITAAFPSACGKTNLAMMKPTLPGYKIECVGDDIAWMKFDKEGRLRAINP-EYGF 66 Query: 702 LEVAPG 719 VAPG Sbjct: 67 FGVAPG 72 Score = 38.3 bits (85), Expect = 9e-05 Identities = 34/105 (32%), Positives = 46/105 (43%), Gaps = 4/105 (3%) Frame = +2 Query: 515 NPQGKKRYIRCRFSFSLRKNEPCHDDATLPRVQVECLGGRHSLD*SSTRTAYSGPLTPEN 694 NP+GKKRYI F + K TLP ++EC+G + + + PE Sbjct: 6 NPKGKKRYITAAFPSACGKTNLAMMKPTLPGYKIECVGDDIAWM-KFDKEGRLRAINPEY 64 Query: 695 GSFGSCTR*RQAATNPVSQWATGFQKT----PGSPNVGGKHLEGL 817 G FG +ATNP + T F+ T S + GG EGL Sbjct: 65 GFFGVAPG-TSSATNP-NAMKTIFKNTIFTNVASTSDGGIFWEGL 107 >M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E30. ). Length = 109 Score = 23.8 bits (49), Expect = 2.0 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -3 Query: 341 GRRANPECHRSRLREDNERTARLDVEFLELR 249 G+ +PE R R E+ ARL EF E R Sbjct: 13 GKNGSPEEKRPRTAFSAEQLARLKREFAENR 43 >M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E60. ). Length = 109 Score = 22.6 bits (46), Expect = 4.6 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -3 Query: 341 GRRANPECHRSRLREDNERTARLDVEFLELR 249 G PE R R E+ ARL EF E R Sbjct: 13 GNGGTPEEKRPRTAFSGEQLARLKREFAENR 43 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.8 bits (44), Expect = 8.0 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 122 WTHNVRDTIL 151 WTHNV D +L Sbjct: 163 WTHNVLDMVL 172 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 237,909 Number of Sequences: 438 Number of extensions: 5013 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26702940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -