BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0452.Seq (678 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 1.7 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 1.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 1.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 1.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.3 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 23 2.3 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 2.3 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 2.3 EF532798-1|ABQ08060.1| 50|Tribolium castaneum acetylcholineste... 22 5.3 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 21 7.0 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 21 7.0 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 9.3 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 9.3 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -2 Query: 644 FRCKNSPESYTCLHRPYENGEMFNMXRRWL 555 +R + S S H P E +N RRW+ Sbjct: 852 YRVEYSAASDAYTHAPEGFNEFYNQRRRWV 881 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -2 Query: 644 FRCKNSPESYTCLHRPYENGEMFNMXRRWL 555 +R + S S H P E +N RRW+ Sbjct: 852 YRVEYSAASDAYTHAPEGFNEFYNQRRRWV 881 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -2 Query: 644 FRCKNSPESYTCLHRPYENGEMFNMXRRWL 555 +R + S S H P E +N RRW+ Sbjct: 852 YRVEYSAASDAYTHAPEGFNEFYNQRRRWV 881 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -2 Query: 644 FRCKNSPESYTCLHRPYENGEMFNMXRRWL 555 +R + S S H P E +N RRW+ Sbjct: 852 YRVEYSAASDAYTHAPEGFNEFYNQRRRWV 881 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/43 (25%), Positives = 18/43 (41%) Frame = +1 Query: 112 EYPKCFIVGADNVGSQQMQQIRISLRGSSIVLMGKNTMMRKAI 240 EYPKC+ V + + +R S KN ++ A+ Sbjct: 2443 EYPKCWQVDCNKGPDSDKEAFAAFVRELSAAFKPKNLLLSAAV 2485 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -2 Query: 644 FRCKNSPESYTCLHRPYENGEMFNMXRRWL 555 +R + S S H P E +N RRW+ Sbjct: 592 YRVEYSAASDAFTHCPEGFNEFYNQRRRWM 621 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -2 Query: 644 FRCKNSPESYTCLHRPYENGEMFNMXRRWL 555 +R + S S H P E +N RRW+ Sbjct: 825 YRVEYSAASDAFTHCPEGFNEFYNQRRRWM 854 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -2 Query: 644 FRCKNSPESYTCLHRPYENGEMFNMXRRWL 555 +R + S S H P E +N RRW+ Sbjct: 825 YRVEYSAASDAFTHCPEGFNEFYNQRRRWM 854 >EF532798-1|ABQ08060.1| 50|Tribolium castaneum acetylcholinesterase protein. Length = 50 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/24 (33%), Positives = 11/24 (45%) Frame = +3 Query: 177 YLATWLQYRAHGKKHNDAQSHQRP 248 YL W+ R + H D +RP Sbjct: 15 YLNIWVPQRLRIRHHGDKPPQERP 38 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.4 bits (43), Expect = 7.0 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 79 NYFVKIIQLLDEYPKCF 129 N KI L+DE+ +CF Sbjct: 214 NLHNKICNLIDEFNECF 230 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.4 bits (43), Expect = 7.0 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -2 Query: 401 QWGNGTRTSW 372 Q+GNG TSW Sbjct: 274 QFGNGLETSW 283 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.0 bits (42), Expect = 9.3 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -3 Query: 313 NTKPTLPLMCGNSFSR 266 N KP + +CG S++R Sbjct: 246 NQKPNVCRICGKSYAR 261 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.0 bits (42), Expect = 9.3 Identities = 9/28 (32%), Positives = 11/28 (39%) Frame = +3 Query: 183 ATWLQYRAHGKKHNDAQSHQRPPGNNPA 266 +TW Y A+ HQ P PA Sbjct: 145 STWCNYSAYSSASRHHVDHQPVPYLTPA 172 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,763 Number of Sequences: 336 Number of extensions: 3771 Number of successful extensions: 13 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17697850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -