BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0452.Seq (678 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 23 2.0 L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein pro... 23 3.5 AB252421-1|BAE80739.1| 122|Apis mellifera GB15078 protein. 21 8.2 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 8.2 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 21 8.2 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/19 (52%), Positives = 12/19 (63%), Gaps = 1/19 (5%) Frame = -2 Query: 638 CKNSPESYTC-LHRPYENG 585 C NSPE+ TC + Y NG Sbjct: 163 CCNSPENNTCSISNSYTNG 181 >L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein protein. Length = 81 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -3 Query: 319 RVNTKPTLPLMCGNSFSRAGLFPG 248 R +T P +CG +FSR L G Sbjct: 37 RTHTLPCKCHLCGKAFSRPWLLQG 60 >AB252421-1|BAE80739.1| 122|Apis mellifera GB15078 protein. Length = 122 Score = 21.4 bits (43), Expect = 8.2 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +3 Query: 153 LATDAADPYLATWLQYRAHGKKHNDAQSHQRPPGNNPALEKL 278 +AT P + TWL+ H Q H+ P GN+ K+ Sbjct: 45 MATGFPRPEI-TWLKDGIELYHHKFFQVHEWPVGNDTLKSKM 85 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = +1 Query: 70 WKSNYFVKIIQLLDEYP 120 W+ F ++++LDE+P Sbjct: 862 WRHWKFPNLVEVLDEFP 878 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -1 Query: 381 DELELGLCSPTVCHGPQR 328 D +E G+ PT C G + Sbjct: 361 DAVEYGIIGPTTCMGDHK 378 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,241 Number of Sequences: 438 Number of extensions: 4235 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -