BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0451.Seq (299 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 21 2.2 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 2.9 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 20 5.0 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 20 6.6 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 21.4 bits (43), Expect = 2.2 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 217 HPRRYVSEFNISS 179 HP R+ +FNISS Sbjct: 101 HPHRFRLKFNISS 113 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.0 bits (42), Expect = 2.9 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -2 Query: 229 CHRRHPRRYVSEFNISSCS 173 C RRH + + ++S+CS Sbjct: 65 CERRHIKGAIPVVSLSTCS 83 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 20.2 bits (40), Expect = 5.0 Identities = 10/39 (25%), Positives = 17/39 (43%) Frame = -2 Query: 265 YTKHTIALNTDGCHRRHPRRYVSEFNISSCSTCKW*CTE 149 Y + T C + +Y+ E +S +TC C+E Sbjct: 36 YNDFEVQRYTWKCENQKCVKYLVEDEETSLATCNMLCSE 74 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 19.8 bits (39), Expect = 6.6 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 233 WLSSTTPASICF 198 W SS P + CF Sbjct: 686 WTSSDNPCTTCF 697 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 47,072 Number of Sequences: 336 Number of extensions: 590 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 48 effective length of database: 106,457 effective search space used: 5429307 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -