BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0448.Seq (499 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g07100.1 68416.m00845 protein transport protein Sec24, putati... 71 3e-13 At4g32640.1 68417.m04646 sec23/sec24 transport protein-related 60 8e-10 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 60 8e-10 At1g20990.1 68414.m02627 DC1 domain-containing protein contains ... 34 0.061 At3g16520.3 68416.m02110 UDP-glucoronosyl/UDP-glucosyl transfera... 29 1.3 At3g16520.2 68416.m02109 UDP-glucoronosyl/UDP-glucosyl transfera... 29 1.3 At3g16520.1 68416.m02108 UDP-glucoronosyl/UDP-glucosyl transfera... 29 1.3 At1g65440.1 68414.m07424 glycine-rich protein 29 1.3 At5g59490.1 68418.m07456 haloacid dehalogenase-like hydrolase fa... 29 2.3 At5g39690.1 68418.m04806 no apical meristem (NAM) protein-relate... 28 3.0 At4g28880.1 68417.m04127 casein kinase, putative similar to simi... 28 3.0 At3g04350.1 68416.m00460 expressed protein 28 3.0 At4g39960.1 68417.m05660 DNAJ heat shock family protein similar ... 27 5.3 At1g54130.1 68414.m06171 RelA/SpoT protein, putative (RSH3) iden... 27 5.3 At5g08270.1 68418.m00974 expressed protein 27 7.0 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 27 7.0 At5g49470.2 68418.m06121 protein kinase family protein contains ... 27 9.3 At5g46070.1 68418.m05665 guanylate-binding family protein contai... 27 9.3 At4g00840.1 68417.m00115 zinc finger (DHHC type) family protein ... 27 9.3 At2g22360.1 68415.m02653 DNAJ heat shock family protein similar ... 27 9.3 >At3g07100.1 68416.m00845 protein transport protein Sec24, putative similar to protein transport protein Sec24A (SEC24-related protein) [Homo sapiens] SWISS-PROT:O95486 Length = 1038 Score = 71.3 bits (167), Expect = 3e-13 Identities = 34/75 (45%), Positives = 48/75 (64%) Frame = +3 Query: 33 PKPPATVFVLDVSYNAVKSGLVDAFCENILDIIRELPKDEQGKSYTRVGFITYSSTVHFY 212 P PP F++DVS +A KSG+++ + I + LP G T++GFITY ST+HFY Sbjct: 443 PMPPIYFFLIDVSISATKSGMLEVVAQTIKSCLDNLP----GYPRTQIGFITYDSTLHFY 498 Query: 213 NIKGSLGQAQMLSVA 257 N+K SL Q QM+ V+ Sbjct: 499 NMKSSLSQPQMMVVS 513 Score = 41.5 bits (93), Expect = 3e-04 Identities = 18/54 (33%), Positives = 34/54 (62%) Frame = +2 Query: 248 VGGDVGDMFVPILEGFLERVEDSGSVLASLLEQIPAMFRENKETETVMLPAVQA 409 V D+ D+FVP+ + L + +S +V+ + L+ +P MF++N E+ PA++A Sbjct: 511 VVSDLDDIFVPLPDDLLVNLSESRTVVDAFLDSLPLMFQDNFNVESAFGPALRA 564 >At4g32640.1 68417.m04646 sec23/sec24 transport protein-related Length = 1069 Score = 60.1 bits (139), Expect = 8e-10 Identities = 30/74 (40%), Positives = 44/74 (59%) Frame = +3 Query: 33 PKPPATVFVLDVSYNAVKSGLVDAFCENILDIIRELPKDEQGKSYTRVGFITYSSTVHFY 212 P P F++DVS NA+++G A C I ++ +LP+ + T VG T+ ST+HFY Sbjct: 502 PMPAVYFFLIDVSMNAIQTGATAAACNAIQQVLSDLPEGPR----TFVGIATFDSTIHFY 557 Query: 213 NIKGSLGQAQMLSV 254 N+K +L Q ML V Sbjct: 558 NLKRALQQPLMLIV 571 Score = 37.1 bits (82), Expect = 0.007 Identities = 19/58 (32%), Positives = 33/58 (56%) Frame = +2 Query: 257 DVGDMFVPILEGFLERVEDSGSVLASLLEQIPAMFRENKETETVMLPAVQAGLEALKA 430 DV D++ P+ + ++ + L LL+ IP MF+E+K E+ AV+A A+K+ Sbjct: 573 DVQDVYTPLETDVVVQLSECRQHLELLLDSIPTMFQESKIPESAFGAAVKAAFLAMKS 630 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 60.1 bits (139), Expect = 8e-10 Identities = 30/74 (40%), Positives = 44/74 (59%) Frame = +3 Query: 33 PKPPATVFVLDVSYNAVKSGLVDAFCENILDIIRELPKDEQGKSYTRVGFITYSSTVHFY 212 P P F++DVS NA+++G A C I ++ +LP+ + T VG T+ ST+HFY Sbjct: 505 PMPAVYFFLIDVSMNAIQTGATAAACSAIQQVLSDLPEGPR----TFVGIATFDSTIHFY 560 Query: 213 NIKGSLGQAQMLSV 254 N+K +L Q ML V Sbjct: 561 NLKRALQQPLMLIV 574 Score = 39.9 bits (89), Expect = 0.001 Identities = 20/58 (34%), Positives = 33/58 (56%) Frame = +2 Query: 257 DVGDMFVPILEGFLERVEDSGSVLASLLEQIPAMFRENKETETVMLPAVQAGLEALKA 430 DV D++ P+ + ++ + L LLE IP MF+E+K E+ AV+A A+K+ Sbjct: 576 DVQDVYTPLETDVIVQLSECRQHLEILLESIPTMFQESKSPESAFGAAVKAAFLAMKS 633 >At1g20990.1 68414.m02627 DC1 domain-containing protein contains Pfam PF03107: DC1 domain; contains weak hit to Pfam PF00569: Zinc finger, ZZ type Length = 319 Score = 33.9 bits (74), Expect = 0.061 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 4/79 (5%) Frame = -3 Query: 227 AALDVVEVNGRAVGDEADAGVALPLLVLGQLPDD----VEDVLAERVDEAALDGVVRHVQ 60 AA++ + NG D++ A + + Q+ D + D L E V EA +DGV R Sbjct: 241 AAVNGLRANGHKGRDKSPAVLGTAARLASQVVIDFLGGIIDGLGEGVGEAIIDGVTRGGG 300 Query: 59 HEHGGRRLRQRVVPAVLGG 3 GG RV+P V GG Sbjct: 301 GGGGGNGGGTRVIPRVRGG 319 >At3g16520.3 68416.m02110 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 462 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 287 EGFLERVEDSGSVLASLLEQIPAM 358 EGFL R ED G V+ S Q+P + Sbjct: 325 EGFLSRTEDKGMVVKSWAPQVPVL 348 >At3g16520.2 68416.m02109 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 446 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 287 EGFLERVEDSGSVLASLLEQIPAM 358 EGFL R ED G V+ S Q+P + Sbjct: 325 EGFLSRTEDKGMVVKSWAPQVPVL 348 >At3g16520.1 68416.m02108 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 451 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 287 EGFLERVEDSGSVLASLLEQIPAM 358 EGFL R ED G V+ S Q+P + Sbjct: 325 EGFLSRTEDKGMVVKSWAPQVPVL 348 >At1g65440.1 68414.m07424 glycine-rich protein Length = 1647 Score = 29.5 bits (63), Expect = 1.3 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 4/60 (6%) Frame = +1 Query: 253 WRRGRHVRAHPGGVP----GEGRGQRLGARLPAGADSRHVQREQGDGDCHAAGRSGWSGS 420 +R G HP G P G GRG+ G R +D + + G+ D A GW S Sbjct: 1468 YRNGGGRDGHPSGAPRPYGGRGRGRGRGRRDDMNSDRQDGNGDWGNNDTGTAD-GGWGNS 1526 >At5g59490.1 68418.m07456 haloacid dehalogenase-like hydrolase family protein low similarity to SP|P53078 SSM1 protein {Saccharomyces cerevisiae}; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase Length = 266 Score = 28.7 bits (61), Expect = 2.3 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +3 Query: 21 NNTLPKPPATVFVLDVSYNAVKSGLVDAFCENILD-IIRELPKDEQG 158 N++ P+ +F LD + + SGL DA NI++ ++ +L DE G Sbjct: 5 NSSPPRYECLLFDLDDTLYPLSSGLSDACSNNIIEYMVEKLGIDEDG 51 >At5g39690.1 68418.m04806 no apical meristem (NAM) protein-related contains Pfam PF02365 : No apical meristem (NAM) protein; similar to NAC domain protein NAC2 (GI:21554255) {Arabidopsis thaliana} Length = 294 Score = 28.3 bits (60), Expect = 3.0 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -3 Query: 137 LPDDVEDVLAERVDEAALDG 78 +PDD+ED LAE ++ +LDG Sbjct: 250 IPDDLEDFLAELMEPHSLDG 269 >At4g28880.1 68417.m04127 casein kinase, putative similar to similar to casein kinase I, delta isoform [Arabidopsis thaliana] SWISS-PROT:P42158; contains protein kinase domain, Pfam:PF00069 Length = 415 Score = 28.3 bits (60), Expect = 3.0 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 334 PAGADSRHVQREQGDGDCHAAGRSGWSGSFES 429 PAG R+V E + + R+GW+ SF S Sbjct: 381 PAGTSKRNVGPETSNSGYGSGNRTGWTSSFMS 412 >At3g04350.1 68416.m00460 expressed protein Length = 567 Score = 28.3 bits (60), Expect = 3.0 Identities = 19/66 (28%), Positives = 31/66 (46%) Frame = +3 Query: 75 NAVKSGLVDAFCENILDIIRELPKDEQGKSYTRVGFITYSSTVHFYNIKGSLGQAQMLSV 254 N+ S L C N +D +LP+DE+ KS + G S+ + ++K +LG + Sbjct: 308 NSTGSNLPAGGC-NDMDFWIDLPEDEEAKSNLKKG--NLESSELYVHVKPALG-GTFTDI 363 Query: 255 ATWATC 272 W C Sbjct: 364 VMWIFC 369 >At4g39960.1 68417.m05660 DNAJ heat shock family protein similar to SP|Q9S5A3 Chaperone protein dnaJ {Listeria monocytogenes}; contains Pfam profiles PF00226 DnaJ domain, PF01556 DnaJ C terminal region, PF00684 DnaJ central domain (4 repeats) Length = 447 Score = 27.5 bits (58), Expect = 5.3 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = +1 Query: 286 GGVPGEGR---GQRLGARLPAGADSRHVQREQGDGDCHAAGRS 405 G G+GR +R+ ++PAG DS R +G+G+ G S Sbjct: 287 GACSGDGRVRRTKRISLKVPAGVDSGSRLRVRGEGNAGKRGGS 329 >At1g54130.1 68414.m06171 RelA/SpoT protein, putative (RSH3) identical to RSH3 (RelA/SpoT homolog) GI:7141308 from [Arabidopsis thaliana]; contains Pfam profiles PF01966: HD domain, PF04607: Region found in RelA / SpoT proteins Length = 712 Score = 27.5 bits (58), Expect = 5.3 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -2 Query: 390 MTVSVSLFSLNMAGICSSREASTEPLSSTLSRNPSRMGTNMSPTSPPTAFGLGL 229 + +++L++ + +CS+ +S L N SR + S TS PT GL L Sbjct: 3 VATTIALYASPASTVCSTAHQINAHISCDLDLN-SRSSSASSSTSSPTIGGLSL 55 >At5g08270.1 68418.m00974 expressed protein Length = 386 Score = 27.1 bits (57), Expect = 7.0 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +2 Query: 239 PNAVGGDVGDMFVPILEGFLERVEDSGSVLASLLEQIPAMFRENKETETVML 394 PN G+ GD+ + E FL R + S+ A +L+ I + + E +ML Sbjct: 316 PNVAFGNTGDVKMGRFESFLSRTGSNSSLDAHVLKTIVLVATKALCNEELML 367 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 27.1 bits (57), Expect = 7.0 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 138 LPKDEQGKSYTRVGFITYSS 197 +PKD K + +GFIT+SS Sbjct: 122 MPKDYNSKQHRGIGFITFSS 141 >At5g49470.2 68418.m06121 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 834 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/61 (24%), Positives = 26/61 (42%) Frame = +1 Query: 310 GQRLGARLPAGADSRHVQREQGDGDCHAAGRSGWSGSFESCRHPPVTCSCSTLRCPLQRG 489 G ++ +++ AG D+ E G GD H + + + +F R T T R + Sbjct: 281 GNKVKSKMRAG-DNNAANLEGGSGDSHQSDQGFFDAAFADRREDAATSGADTPRGDFIQS 339 Query: 490 P 492 P Sbjct: 340 P 340 >At5g46070.1 68418.m05665 guanylate-binding family protein contains Pfam domains PF02263: Guanylate-binding protein, N-terminal domain and PF02841: Guanylate-binding protein, C-terminal domain Length = 1060 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -3 Query: 131 DDVEDVLAE-RVDEAALDGVVRHVQHEHGGRRLRQRVVPAVLG 6 D+++ LA+ R+ E ALD +R HG R + VV +G Sbjct: 911 DNLQQELAQARLKETALDNKIRAASSSHGKRSRFEDVVDMDIG 953 >At4g00840.1 68417.m00115 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 262 Score = 26.6 bits (56), Expect = 9.3 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 8/52 (15%) Frame = +1 Query: 340 GADSRHVQREQGDGDCHAAGRSGWSGSFES------CRH--PPVTCSCSTLR 471 G+ H +RE G GD AG S G+F S CR+ PP CS + Sbjct: 15 GSVPEHFRREMGGGDSLEAGTSTDQGAFGSLGYCTKCRNVKPPRCHHCSVCK 66 >At2g22360.1 68415.m02653 DNAJ heat shock family protein similar to SP|Q9S5A3 Chaperone protein dnaJ {Listeria monocytogenes}; contains Pfam profiles PF00226 DnaJ domain, PF01556 DnaJ C terminal region, PF00684 DnaJ central domain (4 repeats) Length = 442 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = +1 Query: 286 GGVPGEGR---GQRLGARLPAGADSRHVQREQGDGDCHAAGRS 405 G G+GR +R+ ++PAG DS R +G+G+ G S Sbjct: 281 GTCSGDGRVRKTKRISLKVPAGVDSGSRLRVRGEGNAGKRGGS 323 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,316,241 Number of Sequences: 28952 Number of extensions: 211612 Number of successful extensions: 947 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 906 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 944 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -