BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0447.Seq (648 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3577| Best HMM Match : No HMM Matches (HMM E-Value=.) 146 2e-35 SB_46444| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_17219| Best HMM Match : Put_Phosphatase (HMM E-Value=5.7) 29 4.3 SB_10537| Best HMM Match : CTP_transf_2 (HMM E-Value=0) 28 7.5 SB_53506| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_37888| Best HMM Match : Glycos_transf_4 (HMM E-Value=4.1) 27 9.9 SB_33134| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_25189| Best HMM Match : Drf_FH1 (HMM E-Value=4.1) 27 9.9 >SB_3577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1164 Score = 146 bits (353), Expect = 2e-35 Identities = 78/96 (81%), Positives = 83/96 (86%), Gaps = 1/96 (1%) Frame = +1 Query: 352 SADRNVEIWKIKKLIKSLEMARGNGTSMISLIIPPKDQISRVSKMLADEFGTVL-ISSHV 528 +ADRNVEIWKIKKLIKSLE ARGNGTSMISLIIPPKDQISRV+KMLADEFGT I S V Sbjct: 784 AADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADEFGTASNIKSRV 843 Query: 529 *IVSPVLGAITSVQHRLKLYTKVPPNGLVISXGTIV 636 +S VL AITSVQ RLKLY+KVPPNGLV+ GTIV Sbjct: 844 NRLS-VLSAITSVQQRLKLYSKVPPNGLVVYCGTIV 878 >SB_46444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/40 (40%), Positives = 25/40 (62%) Frame = +1 Query: 343 EESSADRNVEIWKIKKLIKSLEMARGNGTSMISLIIPPKD 462 +ES+AD E W+I+KL+K L+ GN T+ I + +D Sbjct: 150 QESNADLPSEYWQIQKLVKYLK--GGNQTATIIALCAMRD 187 >SB_17219| Best HMM Match : Put_Phosphatase (HMM E-Value=5.7) Length = 500 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/27 (48%), Positives = 21/27 (77%) Frame = +1 Query: 316 LNKKRNKMSEESSADRNVEIWKIKKLI 396 L +K++ MSE S+ DR+VE W++K +I Sbjct: 107 LKRKKDVMSE-SAIDRSVEEWELKNVI 132 >SB_10537| Best HMM Match : CTP_transf_2 (HMM E-Value=0) Length = 816 Score = 27.9 bits (59), Expect = 7.5 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +1 Query: 100 KKKSPSNRRRKCKLESVIGVARCLVRPVQTRLGQFE 207 KKK+ R+ C ++ + C RP+ +R+ ++E Sbjct: 720 KKKTNVERKNICVNHDIVYIVICSGRPIDSRINKYE 755 >SB_53506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 378 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 106 SSCAGILGFFLISVTPKHVEHKIQTLQE*KMT 11 ++ AG++ +FL+SV + EHK+ Q K+T Sbjct: 103 ATLAGVIIWFLVSVVNQSEEHKLAIRQNAKIT 134 >SB_37888| Best HMM Match : Glycos_transf_4 (HMM E-Value=4.1) Length = 355 Score = 27.5 bits (58), Expect = 9.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -1 Query: 609 AVWWHFSIQLESVLYRSNCAKHW 541 A WH++I +++Y ++CA W Sbjct: 77 ATMWHYNIAAFAIIYYTSCATVW 99 >SB_33134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2208 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 268 DIILVIYTNIVFVVN*LNKKRNKMSEESSADRNVEI 375 D+ V N+VFV L + R +S + AD++V + Sbjct: 302 DLPTVHLDNVVFVTEDLEESRKPLSNDDQADKSVAV 337 >SB_25189| Best HMM Match : Drf_FH1 (HMM E-Value=4.1) Length = 570 Score = 27.5 bits (58), Expect = 9.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -1 Query: 609 AVWWHFSIQLESVLYRSNCAKHW 541 A WH++I +++Y ++CA W Sbjct: 278 ATVWHYNIATTAIIYYTSCATVW 300 Score = 27.5 bits (58), Expect = 9.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -1 Query: 609 AVWWHFSIQLESVLYRSNCAKHW 541 A WH++I +++Y ++CA W Sbjct: 479 ATMWHYNIAAFAIIYYTSCATVW 501 Score = 27.5 bits (58), Expect = 9.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -1 Query: 609 AVWWHFSIQLESVLYRSNCAKHW 541 A WH++I +++Y ++CA W Sbjct: 498 ATVWHYNIAATAIIYYTSCATVW 520 Score = 27.5 bits (58), Expect = 9.9 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -1 Query: 609 AVWWHFSIQLESVLYRSNCAKHW 541 A WH++I +++Y ++CA W Sbjct: 517 ATVWHYNIAATAIIYYTSCATVW 539 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,288,436 Number of Sequences: 59808 Number of extensions: 404382 Number of successful extensions: 981 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 930 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 977 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -