BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0446.Seq (696 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1703.14c |top1||DNA topoisomerase I|Schizosaccharomyces pomb... 31 0.21 SPCC584.14 |mug160||conserved eukaryotic protein|Schizosaccharom... 26 5.9 SPAC1A6.07 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||... 25 7.8 >SPBC1703.14c |top1||DNA topoisomerase I|Schizosaccharomyces pombe|chr 2|||Manual Length = 814 Score = 30.7 bits (66), Expect = 0.21 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +1 Query: 139 SLTLMRRHSFSSSKRTTLKPSDKKLISTTRKPLTSS 246 SL++ RR SSKR ++K SD++ S+ PL+ S Sbjct: 10 SLSIRRRQRRGSSKRISMKESDEESDSSENHPLSES 45 >SPCC584.14 |mug160||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 431 Score = 25.8 bits (54), Expect = 5.9 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +2 Query: 275 YGEEVTKDYQRS--YEVFARRVLGAAPMPFDKYTFMPSAMDFYQTSLRDPA 421 + E V+ D S +++FA V G +P+ + + F+ DF+ +PA Sbjct: 53 FTESVSNDSFSSLPWQIFANSVAGNSPLQNEAWAFLMDNEDFFLPVPMNPA 103 >SPAC1A6.07 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 636 Score = 25.4 bits (53), Expect = 7.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 580 PASNSKVPKNVGKLTTLTSVS*HHKVK 500 PA ++P N GK TLTS S ++ K Sbjct: 90 PAGPPQIPVNTGKRYTLTSSSANYMTK 116 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,862,724 Number of Sequences: 5004 Number of extensions: 59073 Number of successful extensions: 152 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 152 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -